Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4217
Gene name
LocationContig_28:84367..85920
Strand+
Gene length (bp)1553
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain 6.5E-98 35 426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22781|DDC_CAVPO Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus GN=DDC PE=2 SV=1 1 493 1.0E-124
sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 1 493 5.0E-121
sp|P20711|DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens GN=DDC PE=1 SV=2 1 479 6.0E-120
sp|Q8RY79|TYDC1_ARATH Tyrosine decarboxylase 1 OS=Arabidopsis thaliana GN=ELI5 PE=2 SV=1 1 493 1.0E-119
sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=1 SV=1 1 493 1.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22781|DDC_CAVPO Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus GN=DDC PE=2 SV=1 1 493 1.0E-124
sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 1 493 5.0E-121
sp|P20711|DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens GN=DDC PE=1 SV=2 1 479 6.0E-120
sp|Q8RY79|TYDC1_ARATH Tyrosine decarboxylase 1 OS=Arabidopsis thaliana GN=ELI5 PE=2 SV=1 1 493 1.0E-119
sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=1 SV=1 1 493 1.0E-117
sp|P27718|DDC_BOVIN Aromatic-L-amino-acid decarboxylase OS=Bos taurus GN=DDC PE=2 SV=2 1 499 2.0E-117
sp|Q7XHL3|TYDC1_ORYSJ Tyrosine decarboxylase 1 OS=Oryza sativa subsp. japonica GN=Os07g0437500 PE=2 SV=1 1 493 8.0E-116
sp|P80041|DDC_PIG Aromatic-L-amino-acid decarboxylase OS=Sus scrofa GN=DDC PE=1 SV=2 1 478 6.0E-112
sp|P05031|DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster GN=Ddc PE=1 SV=4 1 479 5.0E-110
sp|Q5EA83|DCHS_BOVIN Histidine decarboxylase OS=Bos taurus GN=HDC PE=2 SV=1 1 493 2.0E-109
sp|O96567|DDC_DROSI Aromatic-L-amino-acid decarboxylase OS=Drosophila simulans GN=Ddc PE=3 SV=2 1 479 3.0E-109
sp|Q95ZS2|TDC1_CAEEL Tyrosine decarboxylase OS=Caenorhabditis elegans GN=tdc-1 PE=2 SV=1 1 493 4.0E-109
sp|P19113|DCHS_HUMAN Histidine decarboxylase OS=Homo sapiens GN=HDC PE=1 SV=2 1 493 1.0E-108
sp|Q9M0G4|TYDC2_ARATH Probable tyrosine decarboxylase 2 OS=Arabidopsis thaliana GN=At4g28680 PE=2 SV=1 1 492 2.0E-107
sp|P16453|DCHS_RAT Histidine decarboxylase OS=Rattus norvegicus GN=Hdc PE=2 SV=2 5 465 2.0E-107
sp|P48861|DDC_MANSE Aromatic-L-amino-acid decarboxylase OS=Manduca sexta GN=Ddc PE=2 SV=1 1 466 3.0E-107
sp|P23738|DCHS_MOUSE Histidine decarboxylase OS=Mus musculus GN=Hdc PE=1 SV=2 10 478 5.0E-106
sp|P54769|TYDC2_PAPSO Tyrosine/DOPA decarboxylase 2 OS=Papaver somniferum GN=TYDC2 PE=2 SV=1 1 498 2.0E-102
sp|P18486|L2AM_DROME Alpha-methyldopa hypersensitive protein OS=Drosophila melanogaster GN=amd PE=2 SV=2 1 424 3.0E-101
sp|Q05733|DCHS_DROME Histidine decarboxylase OS=Drosophila melanogaster GN=Hdc PE=2 SV=2 1 465 3.0E-100
sp|P54768|TYDC1_PAPSO Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum GN=TYDC1 PE=2 SV=1 1 499 4.0E-100
sp|P17770|DDC_CATRO Aromatic-L-amino-acid decarboxylase OS=Catharanthus roseus GN=TDC PE=2 SV=1 1 493 1.0E-98
sp|P54770|TYDC3_PAPSO Tyrosine/DOPA decarboxylase 3 OS=Papaver somniferum GN=TYDC3 PE=2 SV=2 1 498 2.0E-97
sp|Q06086|TYDC2_PETCR Tyrosine decarboxylase 2 OS=Petroselinum crispum GN=TYRDC-2 PE=2 SV=1 1 493 4.0E-96
sp|Q06088|TYDC4_PETCR Tyrosine decarboxylase 4 OS=Petroselinum crispum GN=TYRDC-4 PE=2 SV=1 1 493 2.0E-95
sp|Q06087|TYDC3_PETCR Tyrosine decarboxylase 3 OS=Petroselinum crispum GN=TYRDC-3 PE=2 SV=1 1 493 2.0E-95
sp|P54771|TYDC5_PAPSO Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum GN=TYDC5 PE=2 SV=1 1 493 4.0E-95
sp|Q06085|TYDC1_PETCR Tyrosine decarboxylase 1 (Fragment) OS=Petroselinum crispum GN=TYRDC-1 PE=2 SV=1 5 446 2.0E-89
sp|O96571|DDC_DROLE Aromatic-L-amino-acid decarboxylase (Fragment) OS=Drosophila lebanonensis GN=Ddc PE=3 SV=1 75 466 8.0E-82
sp|O96569|L2AM_DROLE Alpha-methyldopa hypersensitive protein (Fragment) OS=Drosophila lebanonensis GN=amd PE=3 SV=1 74 424 1.0E-73
sp|P81893|L2AM_DROSI Alpha-methyldopa hypersensitive protein (Fragment) OS=Drosophila simulans GN=amd PE=2 SV=1 82 422 6.0E-68
sp|P34751|DDC_CAEEL Probable aromatic-L-amino-acid decarboxylase OS=Caenorhabditis elegans GN=hdl-1 PE=2 SV=3 1 494 9.0E-68
sp|P71362|DDC_HAEIN L-2,4-diaminobutyrate decarboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ddc PE=1 SV=1 74 492 7.0E-24
sp|Q6ZQY3|GADL1_HUMAN Acidic amino acid decarboxylase GADL1 OS=Homo sapiens GN=GADL1 PE=1 SV=4 74 437 1.0E-23
sp|Q28D99|GADL1_XENTR Acidic amino acid decarboxylase GADL1 (Fragment) OS=Xenopus tropicalis GN=gadl1 PE=2 SV=2 20 431 2.0E-23
sp|Q80WP8|GADL1_MOUSE Acidic amino acid decarboxylase GADL1 OS=Mus musculus GN=Gadl1 PE=1 SV=3 74 437 2.0E-23
sp|A6QM00|GADL1_BOVIN Acidic amino acid decarboxylase GADL1 OS=Bos taurus GN=GADL1 PE=2 SV=2 74 437 2.0E-22
sp|P48320|DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus GN=Gad2 PE=1 SV=1 48 441 3.0E-22
sp|Q4PRC2|DCE2_CANLF Glutamate decarboxylase 2 OS=Canis lupus familiaris GN=GAD2 PE=2 SV=1 48 441 6.0E-22
sp|Q05683|DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus GN=Gad2 PE=1 SV=1 48 441 1.0E-21
sp|Q5IS68|DCE1_PANTR Glutamate decarboxylase 1 OS=Pan troglodytes GN=GAD1 PE=2 SV=1 48 440 2.0E-21
sp|P48321|DCE2_PIG Glutamate decarboxylase 2 OS=Sus scrofa GN=GAD2 PE=2 SV=1 48 441 4.0E-21
sp|P18088|DCE1_RAT Glutamate decarboxylase 1 OS=Rattus norvegicus GN=Gad1 PE=2 SV=1 48 440 5.0E-21
sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 48 441 5.0E-21
sp|Q99259|DCE1_HUMAN Glutamate decarboxylase 1 OS=Homo sapiens GN=GAD1 PE=1 SV=1 48 440 8.0E-21
sp|P48319|DCE1_PIG Glutamate decarboxylase 1 OS=Sus scrofa GN=GAD1 PE=2 SV=1 48 440 1.0E-20
sp|P48318|DCE1_MOUSE Glutamate decarboxylase 1 OS=Mus musculus GN=Gad1 PE=1 SV=2 48 440 2.0E-20
sp|Q5R7S7|DCE1_PONAB Glutamate decarboxylase 1 OS=Pongo abelii GN=GAD1 PE=2 SV=1 48 440 2.0E-20
sp|Q64611|CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus GN=Csad PE=1 SV=1 193 441 3.0E-20
sp|P14748|DCE1_FELCA Glutamate decarboxylase 1 OS=Felis catus GN=GAD1 PE=2 SV=3 48 440 4.0E-20
sp|A0PA85|DCE1_CANLF Glutamate decarboxylase 1 OS=Canis lupus familiaris GN=GAD1 PE=2 SV=1 48 440 4.0E-20
sp|Q0VCA1|DCE1_BOVIN Glutamate decarboxylase 1 OS=Bos taurus GN=GAD1 PE=2 SV=1 48 440 7.0E-20
sp|Q9DBE0|CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus GN=Csad PE=1 SV=1 193 441 9.0E-20
sp|Q9Y600|CSAD_HUMAN Cysteine sulfinic acid decarboxylase OS=Homo sapiens GN=CSAD PE=1 SV=2 193 431 1.0E-19
sp|Q43908|DDC_ACIBA L-2,4-diaminobutyrate decarboxylase OS=Acinetobacter baumannii GN=ddc PE=1 SV=1 88 492 8.0E-18
sp|P20228|DCE_DROME Glutamate decarboxylase OS=Drosophila melanogaster GN=Gad1 PE=2 SV=2 162 414 2.0E-17
sp|Q9Z3R1|RHBB_RHIME L-2,4-diaminobutyrate decarboxylase OS=Rhizobium meliloti (strain 1021) GN=rhbB PE=3 SV=1 50 390 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0019752 carboxylic acid metabolic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0016830 carbon-carbon lyase activity Yes
GO:0003824 catalytic activity No
GO:0019842 vitamin binding No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0043167 ion binding No
GO:0043436 oxoacid metabolic process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0070279 vitamin B6 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4217
MDSAEYRRAAKATVDEIADYHDSVASRRVIPDVKPGYLRLRLPASPPEEPEPWEAISADVQAHIMPGITHWASPR
FMAFFPSGNSFPSALAEMWSTALTGANFNWICNPAVTELEALMLDWLALAFGLPECFLSTGSTHGGGVIHSTASE
AIVTVMAAARDAFVAARTAHLSDAHAKEEHHWLLRSRLVALGSSGTHSSTKKAAQILGVRYLDIPVDAATGFALT
GPALAATLADLAARGLEPFFLTATMGTTDVCAVDDFAAIATVLAPRRSSPSKLWVHVDAAYAGSALLLPKHKPTA
ALFSAFDSVNVNPHKWLLVNNDCSTLWLRSRHPLVSAMSVSAPYLVNSFSDASVMPDYRDWQIPLGRRFRALKLW
FVLRSFGLRRLRAHIQHGIDLATRFEASLCQRPDVFRVVTRAAFGLVCFCLVRPSLIEANDATRRLYDEVNAQGA
FFLTSTLLNDEFVVRVQTGVAAVQEEHIDALFAVLLDTATRLLPPLSQE*
Coding >OphauB2|4217
ATGGACAGTGCCGAGTACCGCCGCGCGGCCAAGGCGACTGTTGACGAGATCGCCGACTACCACGACTCTGTTGCC
TCGCGCCGCGTCATTCCCGACGTCAAGCCCGGCTACCTGCGTCTGCGCCTGCCCGCCTCGCCGCCCGAGGAGCCG
GAGCCATGGGAGGCCATTTCGGCCGACGTGCAGGCGCACATTATGCCGGGCATCACGCACTGGGCCAGCCCGCGC
TTCATGGCCTTTTTCCCCTCGGGCAACAGCTTCCCCTCTGCCCTGGCGGAGATGTGGAGCACGGCGCTGACGGGC
GCCAACTTTAACTGGATCTGCAACCCGGCCGTGACGGAGCTCGAGGCCCTCATGCTGGACTGGCTGGCCCTGGCC
TTTGGCTTGCCAGAGTGCTTCTTGAGCACCGGCTCCACGCACGGCGGCGGCGTCATCCACAGCACTGCCAGCGAA
GCCATTGTCACCGTCATGGCGGCTGCCCGCGACGCCTTTGTCGCTGCCCGCACGGCCCACTTGTCCGACGCCCAT
GCCAAGGAGGAGCACCACTGGCTCCTGCGCAGCCGCCTCGTTGCCCTGGGCAGCTCGGGCACCCACTCGAGCACC
AAGAAGGCAGCGCAGATTCTCGGCGTGCGCTACCTGGATATCCCCGTTGACGCTGCCACGGGCTTTGCCCTCACT
GGCCCCGCCCTCGCCGCCACACTCGCCGACTTGGCTGCCCGTGGCCTCGAACCTTTTTTCCTCACCGCCACAATG
GGCACCACCGACGTGTGCGCCGTTGACGACTTTGCCGCCATTGCCACCGTCTTGGCCCCCCGCCGCTCCTCCCCC
TCAAAGCTCTGGGTCCACGTCGACGCCGCCTATGCCGGCTCCGCCCTCCTCCTCCCCAAACACAAACCCACCGCC
GCCCTCTTTTCCGCCTTTGACTCTGTCAATGTCAATCCCCACAAGTGGCTCCTTGTCAATAACGACTGCTCCACC
CTCTGGCTCCGCTCCCGCCACCCCCTCGTCTCCGCCATGTCCGTCTCGGCGCCCTATCTCGTCAATTCCTTTTCC
GATGCGTCCGTCATGCCCGATTATCGCGACTGGCAGATTCCACTCGGTCGTCGCTTTCGCGCCCTCAAGCTTTGG
TTCGTCTTGCGCTCATTTGGCTTGCGCCGACTAAGGGCTCATATCCAGCACGGCATTGACCTTGCCACCCGCTTT
GAAGCTAGTCTTTGCCAGCGGCCAGACGTGTTTAGAGTGGTTACCAGAGCCGCCTTTGGCCTTGTTTGCTTTTGT
CTTGTGCGCCCCTCGCTCATCGAGGCAAATGACGCGACGCGCCGCCTCTATGACGAGGTTAATGCCCAGGGCGCC
TTTTTTCTCACTAGTACCCTTCTCAATGACGAGTTTGTCGTGCGTGTCCAGACGGGCGTCGCGGCCGTGCAAGAG
GAGCACATTGATGCCCTGTTTGCCGTCTTGCTCGACACGGCCACTAGGCTGCTGCCGCCCCTCTCCCAAGAATAG
Transcript >OphauB2|4217
ATGGACAGTGCCGAGTACCGCCGCGCGGCCAAGGCGACTGTTGACGAGATCGCCGACTACCACGACTCTGTTGCC
TCGCGCCGCGTCATTCCCGACGTCAAGCCCGGCTACCTGCGTCTGCGCCTGCCCGCCTCGCCGCCCGAGGAGCCG
GAGCCATGGGAGGCCATTTCGGCCGACGTGCAGGCGCACATTATGCCGGGCATCACGCACTGGGCCAGCCCGCGC
TTCATGGCCTTTTTCCCCTCGGGCAACAGCTTCCCCTCTGCCCTGGCGGAGATGTGGAGCACGGCGCTGACGGGC
GCCAACTTTAACTGGATCTGCAACCCGGCCGTGACGGAGCTCGAGGCCCTCATGCTGGACTGGCTGGCCCTGGCC
TTTGGCTTGCCAGAGTGCTTCTTGAGCACCGGCTCCACGCACGGCGGCGGCGTCATCCACAGCACTGCCAGCGAA
GCCATTGTCACCGTCATGGCGGCTGCCCGCGACGCCTTTGTCGCTGCCCGCACGGCCCACTTGTCCGACGCCCAT
GCCAAGGAGGAGCACCACTGGCTCCTGCGCAGCCGCCTCGTTGCCCTGGGCAGCTCGGGCACCCACTCGAGCACC
AAGAAGGCAGCGCAGATTCTCGGCGTGCGCTACCTGGATATCCCCGTTGACGCTGCCACGGGCTTTGCCCTCACT
GGCCCCGCCCTCGCCGCCACACTCGCCGACTTGGCTGCCCGTGGCCTCGAACCTTTTTTCCTCACCGCCACAATG
GGCACCACCGACGTGTGCGCCGTTGACGACTTTGCCGCCATTGCCACCGTCTTGGCCCCCCGCCGCTCCTCCCCC
TCAAAGCTCTGGGTCCACGTCGACGCCGCCTATGCCGGCTCCGCCCTCCTCCTCCCCAAACACAAACCCACCGCC
GCCCTCTTTTCCGCCTTTGACTCTGTCAATGTCAATCCCCACAAGTGGCTCCTTGTCAATAACGACTGCTCCACC
CTCTGGCTCCGCTCCCGCCACCCCCTCGTCTCCGCCATGTCCGTCTCGGCGCCCTATCTCGTCAATTCCTTTTCC
GATGCGTCCGTCATGCCCGATTATCGCGACTGGCAGATTCCACTCGGTCGTCGCTTTCGCGCCCTCAAGCTTTGG
TTCGTCTTGCGCTCATTTGGCTTGCGCCGACTAAGGGCTCATATCCAGCACGGCATTGACCTTGCCACCCGCTTT
GAAGCTAGTCTTTGCCAGCGGCCAGACGTGTTTAGAGTGGTTACCAGAGCCGCCTTTGGCCTTGTTTGCTTTTGT
CTTGTGCGCCCCTCGCTCATCGAGGCAAATGACGCGACGCGCCGCCTCTATGACGAGGTTAATGCCCAGGGCGCC
TTTTTTCTCACTAGTACCCTTCTCAATGACGAGTTTGTCGTGCGTGTCCAGACGGGCGTCGCGGCCGTGCAAGAG
GAGCACATTGATGCCCTGTTTGCCGTCTTGCTCGACACGGCCACTAGGCTGCTGCCGCCCCTCTCCCAAGAATAG
Gene >OphauB2|4217
ATGGACAGTGCCGAGTACCGCCGCGCGGCCAAGGCGACTGTTGACGAGAGTGAGTCTTTGGTCCACCACGTTGCA
ATGACTGCCCTGCCAATACTTGCCCAGTCGCCGACTACCACGACTCTGTTGCCTCGCGCCGCGTCATTCCCGACG
TCAAGCCCGGCTACCTGCGTCTGCGCCTGCCCGCCTCGCCGCCCGAGGAGCCGGAGCCATGGGAGGCCATTTCGG
CCGACGTGCAGGCGCACATTATGCCGGGCATCACGCACTGGGCCAGCCCGCGCTTCATGGCCTTTTTCCCCTCGG
GCAACAGCTTCCCCTCTGCCCTGGCGGAGATGTGGAGCACGGCGCTGACGGGCGCCAACTTTAACTGGATCTGCA
ACCCGGCCGTGACGGAGCTCGAGGCCCTCATGCTGGACTGGCTGGCCCTGGCCTTTGGCTTGCCAGAGTGCTTCT
TGAGCACCGGCTCCACGCACGGCGGCGGCGTCATCCACAGCACTGCCAGCGAAGCCATTGTCACCGTCATGGCGG
CTGCCCGCGACGCCTTTGTCGCTGCCCGCACGGCCCACTTGTCCGACGCCCATGCCAAGGAGGAGCACCACTGGC
TCCTGCGCAGCCGCCTCGTTGCCCTGGGCAGCTCGGGCACCCACTCGAGCACCAAGAAGGCAGCGCAGATTCTCG
GCGTGCGCTACCTGGATATCCCCGTTGACGCTGCCACGGGCTTTGCCCTCACTGGCCCCGCCCTCGCCGCCACAC
TCGCCGACTTGGCTGCCCGTGGCCTCGAACCTTTTTTCCTCACCGCCACAATGGGCACCACCGACGTGTGCGCCG
TTGACGACTTTGCCGCCATTGCCACCGTCTTGGCCCCCCGCCGCTCCTCCCCCTCAAAGCTCTGGGTCCACGTCG
ACGCCGCCTATGCCGGCTCCGCCCTCCTCCTCCCCAAACACAAACCCACCGCCGCCCTCTTTTCCGCCTTTGACT
CTGTCAATGTCAATCCCCACAAGTGGCTCCTTGTCAATAACGACTGCTCCACCCTCTGGCTCCGCTCCCGCCACC
CCCTCGTCTCCGCCATGTCCGTCTCGGCGCCCTATCTCGTCAATTCCTTTTCCGATGCGTCCGTCATGCCCGATT
ATCGCGACTGGCAGATTCCACTCGGTCGTCGCTTTCGCGCCCTCAAGCTTTGGTTCGTCTTGCGCTCATTTGGCT
TGCGCCGACTAAGGGCTCATATCCAGCACGGCATTGACCTTGCCACCCGCTTTGAAGCTAGTCTTTGCCAGCGGC
CAGACGTGTTTAGAGTGGTTACCAGAGCCGCCTTTGGCCTTGTTTGCTTTTGTCTTGTGCGCCCCTCGCTCATCG
AGGCAAATGACGCGACGCGCCGCCTCTATGACGAGGTTAATGCCCAGGGCGCCTTTTTTCTCACTAGTACCCTTC
TCAATGACGAGTTTGTCGTGCGTGTCCAGACGGGCGTCGCGGCCGTGCAAGAGGAGCACATTGATGCCCTGTTTG
CCGTCTTGCTCGACACGGCCACTAGGCTGCTGCCGCCCCTCTCCCAAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail