Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4216
Gene name
LocationContig_28:81768..84011
Strand+
Gene length (bp)2243
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 3.3E-187 51 650

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 693 2.0E-144
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 5 693 2.0E-142
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 4 693 3.0E-142
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 5 693 4.0E-142
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 4 693 5.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 693 2.0E-144
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 5 693 2.0E-142
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 4 693 3.0E-142
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 5 693 4.0E-142
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 4 693 5.0E-141
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 5 693 2.0E-140
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 6 693 1.0E-136
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 7 693 2.0E-136
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 9 693 1.0E-134
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 8 693 3.0E-131
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 4 693 2.0E-129
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 17 693 5.0E-119
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 19 693 4.0E-118
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 19 693 1.0E-117
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 17 693 1.0E-117
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 4 693 1.0E-101
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 1 693 2.0E-94
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 19 693 4.0E-91
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 13 687 3.0E-90
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 7 693 2.0E-88
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 15 693 5.0E-85
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 26 693 2.0E-80
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 26 693 5.0E-78
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 7 693 5.0E-78
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 26 693 3.0E-76
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 5 693 5.0E-75
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 30 693 7.0E-71
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 26 693 1.0E-69
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 7 693 8.0E-67
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 6 693 7.0E-63
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 283 693 1.0E-59
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 283 693 3.0E-59
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 250 693 2.0E-54
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 250 693 2.0E-54
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 168 693 6.0E-42
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 5 136 3.0E-11
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 27 136 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 284 306 22
3 390 412 22
4 419 441 22
5 456 478 22
6 485 507 22
7 553 575 22
8 582 604 22
9 619 641 22
10 648 670 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4216
MVCIWSLLAVVLLISLSEAFYIPGWSIRSYKPGRQIALLVNKLYSDKTQLQYAYHDVPFVCQPTGRHGLGGQSMA
LNLGEVLRGDRITVSDMELVMGQDKRCELLCTRELSGDEVARARELIEEGYAVEWVVDNLPGATSFVTSDKTKKY
YAAGFKLGYSETTAKTGRQRYLLHNHHTIVIRHGRAPGRAGARGEQVIVGFEVYPKSIGSEVERDGTGCPVNVEH
VEGALELRAEANKTRLDESGEAVLSVPYTYSVYFRRDDSMDWAHRWDYYFVNQDQGSRIHWLAIANSLMMCGLMA
GIVAIIMTRTIGSDIKGYREVAAQEARARRSRGKGKPAGLLDRGTSDDDDDGDASDGDYEALEEVTGWKLLHGDV
FRPPRHGKMLAPLVGSGTQLLFMALGLVLLSAVGVLNPSFRGGFLSVGMGLFIFAGLFSGYFSARVYCSLTMGRD
YVRNAVVTGLLFPGLAFGLVLVVNLFVWAQASSTAIPFGTLAGLAALWLCVQMPLVLAGAYHGHVNAGPWQHPAK
TKTNPTAAAPPRRIPPQPWYLQTLPSALLAGLLPFAVVLIELLFVLQSVWQDKSGYYYLFGYLCLVLLLLLVAVA
EVSVVAVYMQLCAENYAWWWRSVCVGGGSAVWVFGYCVWYFVYKLHVVGFVSGLLFFAYSLMACCVYALLTGTVG
FLSAYAFVRRIYGAIKID*
Coding >OphauB2|4216
ATGGTTTGCATCTGGAGCCTGCTGGCTGTTGTGCTGCTGATTAGCCTGAGCGAGGCATTTTACATTCCGGGTTGG
TCGATTCGGAGCTACAAGCCCGGGCGGCAGATTGCTCTGCTGGTCAACAAGCTCTACTCGGACAAGACGCAGCTG
CAGTATGCCTACCACGACGTGCCCTTTGTGTGCCAGCCGACGGGCCGACACGGGCTGGGGGGCCAGAGCATGGCG
CTGAATCTGGGCGAGGTGCTGCGGGGCGACCGCATTACTGTTTCCGACATGGAGCTCGTCATGGGCCAGGACAAG
AGGTGCGAGTTGCTGTGCACGCGGGAGCTGTCGGGCGACGAGGTGGCGCGGGCGCGAGAGCTGATTGAAGAGGGC
TATGCGGTGGAGTGGGTGGTGGACAACCTGCCCGGGGCAACAAGCTTTGTGACGAGCGACAAGACCAAGAAGTAC
TATGCGGCCGGCTTCAAGCTCGGCTACAGCGAGACGACGGCCAAGACGGGCAGGCAACGCTACCTGCTGCACAAC
CACCACACGATAGTGATTCGGCACGGCAGGGCGCCTGGGCGGGCGGGGGCTCGGGGCGAGCAAGTCATTGTGGGA
TTTGAAGTCTACCCCAAGAGCATTGGCAGCGAGGTGGAGCGAGACGGCACGGGCTGTCCTGTCAATGTCGAGCAC
GTTGAAGGAGCGCTGGAGCTGCGTGCCGAGGCCAACAAGACTAGGCTGGACGAGTCTGGAGAGGCGGTGCTGTCG
GTGCCGTATACATACTCGGTCTACTTTCGGCGCGACGACAGCATGGACTGGGCTCACCGATGGGACTATTACTTT
GTCAACCAGGATCAAGGGTCGCGCATCCACTGGCTAGCCATTGCCAACTCGCTCATGATGTGCGGGCTCATGGCG
GGCATCGTGGCCATCATCATGACGCGGACGATTGGCTCCGACATCAAGGGCTACCGGGAAGTGGCAGCGCAAGAG
GCACGGGCGCGGCGATCACGGGGCAAAGGCAAGCCAGCAGGCCTCTTGGACAGGGGCACGAGCGACGACGACGAC
GACGGCGACGCATCAGACGGCGACTACGAAGCGCTCGAGGAGGTTACGGGATGGAAGCTGCTGCACGGCGACGTG
TTTAGACCGCCGCGGCACGGCAAGATGCTGGCGCCACTAGTCGGCTCGGGGACGCAGCTGCTCTTCATGGCGCTG
GGCCTGGTGCTGCTGAGCGCCGTGGGCGTGCTCAACCCCAGCTTCCGGGGCGGCTTCTTAAGCGTGGGCATGGGC
CTCTTCATCTTTGCCGGCCTCTTTTCCGGCTACTTTTCAGCACGCGTCTATTGCAGCTTGACAATGGGCCGCGAC
TATGTGCGCAACGCCGTGGTGACGGGCCTCTTGTTCCCCGGGCTGGCATTTGGCCTGGTGCTTGTGGTGAATCTC
TTTGTCTGGGCGCAGGCGTCGAGCACGGCCATTCCCTTTGGCACGCTGGCCGGCCTGGCGGCGCTGTGGCTGTGC
GTGCAGATGCCGCTGGTGCTGGCGGGCGCATACCACGGCCACGTCAATGCTGGCCCATGGCAGCACCCAGCCAAG
ACCAAGACCAACCCGACTGCTGCAGCGCCACCACGACGCATCCCCCCGCAGCCGTGGTATCTGCAAACACTGCCG
TCTGCGCTACTGGCCGGCCTGCTGCCCTTTGCCGTGGTGCTGATTGAGCTGCTCTTTGTCCTGCAGTCGGTGTGG
CAGGACAAGAGCGGCTACTACTACCTCTTTGGCTACCTCTGCCTCGTCTTGCTGCTGCTCCTGGTGGCGGTGGCC
GAGGTGTCCGTCGTTGCCGTCTATATGCAGCTGTGCGCCGAGAATTACGCGTGGTGGTGGCGCTCCGTGTGCGTG
GGCGGCGGGAGCGCCGTGTGGGTGTTTGGGTATTGCGTGTGGTATTTTGTCTACAAGCTGCACGTGGTGGGCTTT
GTGAGCGGGCTGCTGTTTTTTGCCTATAGCTTGATGGCGTGTTGTGTGTATGCGCTGTTGACGGGCACCGTGGGC
TTTTTGAGTGCCTATGCCTTTGTGCGGCGCATCTATGGAGCCATCAAGATTGACTAG
Transcript >OphauB2|4216
ATGGTTTGCATCTGGAGCCTGCTGGCTGTTGTGCTGCTGATTAGCCTGAGCGAGGCATTTTACATTCCGGGTTGG
TCGATTCGGAGCTACAAGCCCGGGCGGCAGATTGCTCTGCTGGTCAACAAGCTCTACTCGGACAAGACGCAGCTG
CAGTATGCCTACCACGACGTGCCCTTTGTGTGCCAGCCGACGGGCCGACACGGGCTGGGGGGCCAGAGCATGGCG
CTGAATCTGGGCGAGGTGCTGCGGGGCGACCGCATTACTGTTTCCGACATGGAGCTCGTCATGGGCCAGGACAAG
AGGTGCGAGTTGCTGTGCACGCGGGAGCTGTCGGGCGACGAGGTGGCGCGGGCGCGAGAGCTGATTGAAGAGGGC
TATGCGGTGGAGTGGGTGGTGGACAACCTGCCCGGGGCAACAAGCTTTGTGACGAGCGACAAGACCAAGAAGTAC
TATGCGGCCGGCTTCAAGCTCGGCTACAGCGAGACGACGGCCAAGACGGGCAGGCAACGCTACCTGCTGCACAAC
CACCACACGATAGTGATTCGGCACGGCAGGGCGCCTGGGCGGGCGGGGGCTCGGGGCGAGCAAGTCATTGTGGGA
TTTGAAGTCTACCCCAAGAGCATTGGCAGCGAGGTGGAGCGAGACGGCACGGGCTGTCCTGTCAATGTCGAGCAC
GTTGAAGGAGCGCTGGAGCTGCGTGCCGAGGCCAACAAGACTAGGCTGGACGAGTCTGGAGAGGCGGTGCTGTCG
GTGCCGTATACATACTCGGTCTACTTTCGGCGCGACGACAGCATGGACTGGGCTCACCGATGGGACTATTACTTT
GTCAACCAGGATCAAGGGTCGCGCATCCACTGGCTAGCCATTGCCAACTCGCTCATGATGTGCGGGCTCATGGCG
GGCATCGTGGCCATCATCATGACGCGGACGATTGGCTCCGACATCAAGGGCTACCGGGAAGTGGCAGCGCAAGAG
GCACGGGCGCGGCGATCACGGGGCAAAGGCAAGCCAGCAGGCCTCTTGGACAGGGGCACGAGCGACGACGACGAC
GACGGCGACGCATCAGACGGCGACTACGAAGCGCTCGAGGAGGTTACGGGATGGAAGCTGCTGCACGGCGACGTG
TTTAGACCGCCGCGGCACGGCAAGATGCTGGCGCCACTAGTCGGCTCGGGGACGCAGCTGCTCTTCATGGCGCTG
GGCCTGGTGCTGCTGAGCGCCGTGGGCGTGCTCAACCCCAGCTTCCGGGGCGGCTTCTTAAGCGTGGGCATGGGC
CTCTTCATCTTTGCCGGCCTCTTTTCCGGCTACTTTTCAGCACGCGTCTATTGCAGCTTGACAATGGGCCGCGAC
TATGTGCGCAACGCCGTGGTGACGGGCCTCTTGTTCCCCGGGCTGGCATTTGGCCTGGTGCTTGTGGTGAATCTC
TTTGTCTGGGCGCAGGCGTCGAGCACGGCCATTCCCTTTGGCACGCTGGCCGGCCTGGCGGCGCTGTGGCTGTGC
GTGCAGATGCCGCTGGTGCTGGCGGGCGCATACCACGGCCACGTCAATGCTGGCCCATGGCAGCACCCAGCCAAG
ACCAAGACCAACCCGACTGCTGCAGCGCCACCACGACGCATCCCCCCGCAGCCGTGGTATCTGCAAACACTGCCG
TCTGCGCTACTGGCCGGCCTGCTGCCCTTTGCCGTGGTGCTGATTGAGCTGCTCTTTGTCCTGCAGTCGGTGTGG
CAGGACAAGAGCGGCTACTACTACCTCTTTGGCTACCTCTGCCTCGTCTTGCTGCTGCTCCTGGTGGCGGTGGCC
GAGGTGTCCGTCGTTGCCGTCTATATGCAGCTGTGCGCCGAGAATTACGCGTGGTGGTGGCGCTCCGTGTGCGTG
GGCGGCGGGAGCGCCGTGTGGGTGTTTGGGTATTGCGTGTGGTATTTTGTCTACAAGCTGCACGTGGTGGGCTTT
GTGAGCGGGCTGCTGTTTTTTGCCTATAGCTTGATGGCGTGTTGTGTGTATGCGCTGTTGACGGGCACCGTGGGC
TTTTTGAGTGCCTATGCCTTTGTGCGGCGCATCTATGGAGCCATCAAGATTGACTAG
Gene >OphauB2|4216
ATGGTTTGCATCTGGAGCCTGCTGGCTGTTGTGCTGCTGATTAGCCTGAGCGAGGCATTTTACATTCCGGGTTGG
TCGATTCGGAGCTACAAGCCCGGGCGGCAGATTGCTCTGCTGGTCAACAAGCTCTACTCGGACAAGACGCAGCTG
CAGTATGCCTACCACGACGTGCCCTTTGTGTGCCAGCCGACGGGCCGACACGGGCTGGGGGGCCAGAGCATGGCG
CTGAATCTGGGCGAGGTGCTGCGGGGCGACCGCATTACTGTTTCCGACATGGAGCTCGTCATGGGCCAGGACAAG
AGGTGCGAGTTGCTGTGCACGCGGGAGCTGTCGGGCGACGAGGTGGCGCGGGCGCGAGAGCTGATTGAAGAGGGC
TATGCGGTGGAGTGGGTGGTGGACAACCTGCCCGGGGCAACAAGCTTTGTGACGAGCGACAAGACCAAGAAGTAC
TATGCGGCCGGCTTCAAGCTCGGCTACAGCGAGACGACGGCCAAGACGGGCAGGCAACGCTACCTGCTGCACAAC
CACCACACGATAGTGATTCGGCACGGCAGGGCGCCTGGGCGGGCGGGGGCTCGGGGCGAGCAAGTCATTGTGGGA
TTTGAAGTCTACCCCAAGAGCATTGGCAGCGAGGTGGAGCGAGACGGCACGGGCTGTCCTGTCAATGTCGAGCAC
GTTGAAGGAGCGCTGGAGCTGCGTGCCGAGGCCAACAAGACTAGGCTGGACGAGTCTGGAGAGGCGGTGCTGTCG
GTGCCGTATACATACTCGGTCTACTTTCGGCGCGACGACAGCATGGACTGGGCTCACCGATGGGACTATTACTTT
GTCAACCAGGATCAAGGGTCGCGCATCCACTGGCTAGCCATTGCCAACTCGCTCATGATGTGCGGGCTCATGGCG
GGCATCGTGGCCATCATCATGACGCGGACGATTGGCTCCGACATCAAGGGCTACCGGGAAGTGGCAGCGCAAGAG
GCACGGGCGCGGCGATCACGGGGCAAAGGCAAGCCAGCAGGCCTCTTGGACAGGGGCACGAGCGACGACGACGAC
GACGGCGACGCATCAGACGGCGACTACGAAGCGCTCGAGGAGGTTACGGGATGGAAGCTGCTGCACGGCGACGTG
TTTAGACCGCCGCGGCACGGCAAGATGCTGGCGCCACTAGTCGGCTCGGGGACGCAGCTGCTCTTCATGGCGCTG
GGCCTGGTGCTGCTGAGCGCCGTGGGCGTGCTCAACCCCAGCTTCCGGGGCGGCTTCTTAAGCGTGGGCATGGGC
CTCTTCATCTTTGCCGGCCTCTTTTCCGGCTACTTTTCAGCACGCGTCTATTGCAGCTTGACAATGGGCCGCGAC
TATGTGCGCAACGCCGTGGTGACGGGCCTCTTGTTCCCCGGGCTGGCATTTGGCCTGGTGCTTGTGGTGAATCTC
TTTGTCTGGGCGCAGGCGTCGAGCACGGCCATTCCCTTTGGCACGCTGGCCGGCCTGGCGGCGCTGTGGCTGTGC
GTGCAGATGCCGCTGGTGCTGGCGGGCGCATACCACGGCCACGTCAATGCTGGCCCATGGCAGCACCCAGCCAAG
ACCAAGACCAACCCGACTGCTGCAGCGCCACCACGACGCATCCCCCCGCAGCCGTGGTATCTGCAAACACTGCCG
TCTGCGCTACTGGCCGGCCTGCTGCCCTTTGCCGTGGTGCTGATTGAGCTGCTCTTTGTCCTGCAGTCGGTGTGG
CAGGACAAGAGCGGCTACTACTACCTCTTTGGCTACCTCTGCCTCGTCTTGCTGCTGCTCCTGGTGGCGGTGGCC
GAGGTGTCCGTCGTTGCCGTCTATATGCAGCTGTGCGCCGAGAATTACGCGTGGTGGTGGCGCTCCGTGTGCGTG
GGCGGCGGGAGCGCCGTGTGGGTGTTTGGGTATTGCGTGTGGTATTTTGTCTACAAGCTGCACGTGGTGGGCTTT
GTGAGCGGGCTGCTGTTTTTTGCCTATAGCTTGATGGCGTGTTGTGTGTATGCGCTGTTGACGGGCACCGTGGGC
TTTTTGAGTGCCTATGCCTTTGTGCGGCGCATCTATGGGTGAGTTATGTCTTTGCTGCTCCCAGTCTTTTGCTCC
TTGGTTTTTGCTCCTTGGCTTTTGCTGCTTGGCTTTTGCTGCTTGGCGCTTGCTGCTTGGCGCTTGCTGCTTGGC
TTTTGCTGCTTTGTATTGGCGACACAAGGGGCTGACCGTCATCATTTAGAGCCATCAAGATTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail