Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4214
Gene name
LocationContig_28:75400..76776
Strand+
Gene length (bp)1376
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 2.6E-55 49 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XUC4|HKE41_CAEEL Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis elegans GN=hke-4.1 PE=2 SV=2 52 381 3.0E-45
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus GN=Slc39a7 PE=1 SV=2 52 355 2.0E-44
sp|A8WMY3|HKE41_CAEBR Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis briggsae GN=hke-4.1 PE=3 SV=2 52 381 4.0E-44
sp|P40544|YKE4_YEAST Zinc transporter YKE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE4 PE=1 SV=1 51 383 2.0E-43
sp|Q9UT11|YLW3_SCHPO Uncharacterized zinc transporter P8A3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.03 PE=3 SV=1 45 380 7.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XUC4|HKE41_CAEEL Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis elegans GN=hke-4.1 PE=2 SV=2 52 381 3.0E-45
sp|Q31125|S39A7_MOUSE Zinc transporter SLC39A7 OS=Mus musculus GN=Slc39a7 PE=1 SV=2 52 355 2.0E-44
sp|A8WMY3|HKE41_CAEBR Histidine-rich membrane protein KE4 homolog 1 OS=Caenorhabditis briggsae GN=hke-4.1 PE=3 SV=2 52 381 4.0E-44
sp|P40544|YKE4_YEAST Zinc transporter YKE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE4 PE=1 SV=1 51 383 2.0E-43
sp|Q9UT11|YLW3_SCHPO Uncharacterized zinc transporter P8A3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.03 PE=3 SV=1 45 380 7.0E-43
sp|Q92504|S39A7_HUMAN Zinc transporter SLC39A7 OS=Homo sapiens GN=SLC39A7 PE=1 SV=2 52 355 3.0E-42
sp|Q5TJF6|S39A7_CANLF Zinc transporter SLC39A7 OS=Canis lupus familiaris GN=SLC39A7 PE=3 SV=1 52 355 2.0E-41
sp|Q9XTQ7|HKE42_CAEEL Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis elegans GN=hke-4.2 PE=3 SV=2 50 350 4.0E-41
sp|Q5RFD5|S39A7_PONAB Zinc transporter SLC39A7 OS=Pongo abelii GN=SLC39A7 PE=2 SV=1 52 355 3.0E-38
sp|Q9VAF0|S39AD_DROME Zinc transporter ZIP13 homolog OS=Drosophila melanogaster GN=Zip99C PE=2 SV=1 75 377 5.0E-38
sp|Q5ZI20|S39AD_CHICK Zinc transporter ZIP13 OS=Gallus gallus GN=SLC39A13 PE=2 SV=1 79 351 3.0E-37
sp|Q8BZH0|S39AD_MOUSE Zinc transporter ZIP13 OS=Mus musculus GN=Slc39a13 PE=2 SV=1 79 360 4.0E-35
sp|Q2M1K6|S39AD_RAT Zinc transporter ZIP13 OS=Rattus norvegicus GN=Slc39a13 PE=2 SV=1 79 365 1.0E-34
sp|Q8AW42|S39AD_DANRE Zinc transporter ZIP13 OS=Danio rerio GN=slc39a13 PE=2 SV=1 73 349 4.0E-34
sp|A8X482|HKE42_CAEBR Histidine-rich membrane protein KE4 homolog 2 OS=Caenorhabditis briggsae GN=hke-4.2 PE=3 SV=2 209 350 1.0E-33
sp|Q9V3A4|CSUP_DROME Protein catecholamines up OS=Drosophila melanogaster GN=Catsup PE=2 SV=1 55 381 2.0E-33
sp|Q9PUB8|S39A7_DANRE Zinc transporter Slc39a7 (Fragment) OS=Danio rerio GN=slc39a7 PE=2 SV=1 50 266 1.0E-31
sp|Q96H72|S39AD_HUMAN Zinc transporter ZIP13 OS=Homo sapiens GN=SLC39A13 PE=1 SV=3 79 351 4.0E-31
sp|Q9M647|IAR1_ARATH IAA-alanine resistance protein 1 OS=Arabidopsis thaliana GN=IAR1 PE=1 SV=3 50 381 8.0E-27
sp|A5D7H1|S39AD_BOVIN Zinc transporter ZIP13 OS=Bos taurus GN=SLC39A13 PE=2 SV=1 79 297 4.0E-26
sp|Q5R6I6|S39AD_PONAB Zinc transporter ZIP13 OS=Pongo abelii GN=SLC39A13 PE=2 SV=1 203 360 3.0E-25
sp|Q504Y0|S39AC_HUMAN Zinc transporter ZIP12 OS=Homo sapiens GN=SLC39A12 PE=2 SV=3 78 347 5.0E-24
sp|Q1KZG0|S39A4_BOVIN Zinc transporter ZIP4 OS=Bos taurus GN=SLC39A4 PE=1 SV=1 78 351 1.0E-21
sp|Q5FWH7|S39AC_MOUSE Zinc transporter ZIP12 OS=Mus musculus GN=Slc39a12 PE=1 SV=1 78 347 3.0E-21
sp|Q95KA5|S39AC_MACFA Zinc transporter ZIP12 OS=Macaca fascicularis GN=SLC39A12 PE=2 SV=1 78 347 9.0E-20
sp|Q08E40|S39AC_BOVIN Zinc transporter ZIP12 OS=Bos taurus GN=SLC39A12 PE=2 SV=1 78 347 1.0E-19
sp|Q6PEH9|S39AA_DANRE Zinc transporter ZIP10 OS=Danio rerio GN=slc39a10 PE=2 SV=1 215 381 1.0E-18
sp|Q5FVQ0|S39A8_RAT Zinc transporter ZIP8 OS=Rattus norvegicus GN=Slc39a8 PE=2 SV=1 78 347 5.0E-18
sp|Q6P5F6|S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus GN=Slc39a10 PE=1 SV=1 163 348 5.0E-18
sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens GN=SLC39A10 PE=1 SV=2 205 348 5.0E-18
sp|A4IGY6|S39AE_XENTR Zinc transporter ZIP14 OS=Xenopus tropicalis GN=slc39a14 PE=2 SV=1 78 384 6.0E-18
sp|Q13433|S39A6_HUMAN Zinc transporter ZIP6 OS=Homo sapiens GN=SLC39A6 PE=1 SV=3 202 381 3.0E-17
sp|Q5R9M9|S39A6_PONAB Zinc transporter ZIP6 OS=Pongo abelii GN=SLC39A6 PE=2 SV=1 202 381 3.0E-17
sp|A0JPN2|S39A4_RAT Zinc transporter ZIP4 OS=Rattus norvegicus GN=Slc39a4 PE=2 SV=1 78 351 5.0E-17
sp|Q78IQ7|S39A4_MOUSE Zinc transporter ZIP4 OS=Mus musculus GN=Slc39a4 PE=1 SV=1 78 351 8.0E-17
sp|Q91W10|S39A8_MOUSE Zinc transporter ZIP8 OS=Mus musculus GN=Slc39a8 PE=2 SV=1 78 347 8.0E-17
sp|Q4V887|S39A6_RAT Zinc transporter ZIP6 OS=Rattus norvegicus GN=Slc39a6 PE=1 SV=1 202 381 9.0E-17
sp|Q8C145|S39A6_MOUSE Zinc transporter ZIP6 OS=Mus musculus GN=Slc39a6 PE=1 SV=1 202 381 1.0E-16
sp|A5D7L5|S39AE_BOVIN Zinc transporter ZIP14 OS=Bos taurus GN=SLC39A14 PE=2 SV=1 78 384 1.0E-15
sp|Q75N73|S39AE_MOUSE Zinc transporter ZIP14 OS=Mus musculus GN=Slc39a14 PE=1 SV=1 78 384 3.0E-15
sp|Q15043|S39AE_HUMAN Zinc transporter ZIP14 OS=Homo sapiens GN=SLC39A14 PE=1 SV=3 78 384 3.0E-15
sp|Q5RAB7|S39AE_PONAB Zinc transporter ZIP14 OS=Pongo abelii GN=SLC39A14 PE=2 SV=2 78 384 4.0E-15
sp|Q9VSL7|FOI_DROME Zinc transporter foi OS=Drosophila melanogaster GN=foi PE=1 SV=3 215 383 2.0E-14
sp|Q9C0K1|S39A8_HUMAN Zinc transporter ZIP8 OS=Homo sapiens GN=SLC39A8 PE=2 SV=1 78 347 8.0E-14
sp|Q9D856|S39A5_MOUSE Zinc transporter ZIP5 OS=Mus musculus GN=Slc39a5 PE=1 SV=1 78 355 1.0E-13
sp|Q6P5W5|S39A4_HUMAN Zinc transporter ZIP4 OS=Homo sapiens GN=SLC39A4 PE=1 SV=3 78 351 2.0E-13
sp|Q6ZMH5|S39A5_HUMAN Zinc transporter ZIP5 OS=Homo sapiens GN=SLC39A5 PE=1 SV=3 84 269 7.0E-11
sp|Q55FL1|ZNTA_DICDI Protein zntA OS=Dictyostelium discoideum GN=zntA PE=2 SV=2 224 357 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0030001 metal ion transport Yes
GO:0051179 localization No
GO:0006811 ion transport No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006812 cation transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 77 99 22
3 123 140 17
4 274 296 22
5 326 348 22
6 360 382 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4214
MSLAAIEAELQTCEIVQQLKAARTETAGHEPSWSTQRLFGMLFPSSHAGINALLATAYISGPPNLLLALCPTKLD
AGLLGTMVAFAVGGLLGDAFFHLLPEIFLGEGEDHGAARFVLVEPNRNLLLGLGVLFGFVIFVALDKGMRIATGG
AHSHGHEGHGDDGSEDEAVAETTGAQTADGAMRLRKSKAKNTAVARVQEDKADKHDKTSLKLGGYLNLVADFTHN
VTDGLAMAASFYASPTVGATTAVAVFMHEIPHEVGDFALLVQSGFSKRAAMASQFVTALGALLGTLIGIAVQELG
GQGGRGGDDMARNEGIWGTSLSWGDMLLPFTAGTFIYVGTVAAIPELLENRPGQSKTEAIRGAAAQFAAMAMGAA
IMLYISWHS*
Coding >OphauB2|4214
ATGAGCCTCGCAGCCATTGAAGCGGAGCTGCAGACGTGTGAGATTGTGCAGCAGCTCAAGGCGGCACGGACAGAG
ACGGCAGGCCACGAGCCATCGTGGTCGACACAGCGACTGTTTGGCATGCTCTTTCCCAGCTCCCACGCAGGCATC
AACGCATTGCTGGCCACGGCGTACATTTCAGGCCCTCCGAATCTGCTGCTGGCCTTGTGTCCGACCAAGTTGGAT
GCCGGGCTGCTAGGCACCATGGTGGCCTTTGCCGTGGGCGGGCTGCTTGGCGATGCCTTTTTCCACCTGCTGCCC
GAGATATTCCTGGGCGAGGGCGAGGACCACGGCGCGGCGCGGTTTGTGCTTGTTGAGCCCAATAGGAATCTCTTG
CTCGGTCTCGGAGTTCTCTTTGGCTTTGTCATTTTTGTTGCTCTGGACAAGGGCATGCGCATCGCGACTGGAGGG
GCGCACAGCCATGGACACGAGGGGCATGGCGACGACGGCAGCGAGGACGAAGCAGTGGCCGAGACAACAGGGGCG
CAGACGGCAGACGGAGCGATGCGGCTGAGGAAGAGCAAGGCAAAGAACACGGCAGTAGCTAGAGTGCAAGAGGAC
AAGGCTGACAAGCACGACAAGACGAGTCTGAAGCTGGGTGGCTATCTAAATCTAGTAGCCGACTTTACGCACAAC
GTGACGGATGGGCTGGCCATGGCTGCCAGCTTCTACGCTTCACCAACAGTGGGCGCCACCACGGCCGTTGCAGTC
TTCATGCACGAGATTCCACACGAGGTGGGCGACTTTGCTCTGCTGGTGCAGTCGGGCTTCTCCAAGCGAGCGGCC
ATGGCGTCGCAGTTTGTCACGGCCCTGGGCGCTCTGCTGGGCACCTTGATTGGCATTGCAGTGCAGGAGCTGGGC
GGGCAGGGCGGCCGAGGAGGCGACGACATGGCTCGAAACGAGGGCATCTGGGGAACCAGTCTTAGCTGGGGAGAC
ATGCTGCTGCCCTTTACCGCAGGCACCTTTATCTACGTGGGCACCGTGGCCGCGATTCCAGAGCTGCTCGAGAAT
AGGCCAGGGCAGAGCAAGACGGAGGCGATTCGGGGTGCGGCGGCGCAGTTTGCGGCCATGGCCATGGGAGCAGCC
ATCATGCTGTACATTTCGTGGCACAGCTGA
Transcript >OphauB2|4214
ATGAGCCTCGCAGCCATTGAAGCGGAGCTGCAGACGTGTGAGATTGTGCAGCAGCTCAAGGCGGCACGGACAGAG
ACGGCAGGCCACGAGCCATCGTGGTCGACACAGCGACTGTTTGGCATGCTCTTTCCCAGCTCCCACGCAGGCATC
AACGCATTGCTGGCCACGGCGTACATTTCAGGCCCTCCGAATCTGCTGCTGGCCTTGTGTCCGACCAAGTTGGAT
GCCGGGCTGCTAGGCACCATGGTGGCCTTTGCCGTGGGCGGGCTGCTTGGCGATGCCTTTTTCCACCTGCTGCCC
GAGATATTCCTGGGCGAGGGCGAGGACCACGGCGCGGCGCGGTTTGTGCTTGTTGAGCCCAATAGGAATCTCTTG
CTCGGTCTCGGAGTTCTCTTTGGCTTTGTCATTTTTGTTGCTCTGGACAAGGGCATGCGCATCGCGACTGGAGGG
GCGCACAGCCATGGACACGAGGGGCATGGCGACGACGGCAGCGAGGACGAAGCAGTGGCCGAGACAACAGGGGCG
CAGACGGCAGACGGAGCGATGCGGCTGAGGAAGAGCAAGGCAAAGAACACGGCAGTAGCTAGAGTGCAAGAGGAC
AAGGCTGACAAGCACGACAAGACGAGTCTGAAGCTGGGTGGCTATCTAAATCTAGTAGCCGACTTTACGCACAAC
GTGACGGATGGGCTGGCCATGGCTGCCAGCTTCTACGCTTCACCAACAGTGGGCGCCACCACGGCCGTTGCAGTC
TTCATGCACGAGATTCCACACGAGGTGGGCGACTTTGCTCTGCTGGTGCAGTCGGGCTTCTCCAAGCGAGCGGCC
ATGGCGTCGCAGTTTGTCACGGCCCTGGGCGCTCTGCTGGGCACCTTGATTGGCATTGCAGTGCAGGAGCTGGGC
GGGCAGGGCGGCCGAGGAGGCGACGACATGGCTCGAAACGAGGGCATCTGGGGAACCAGTCTTAGCTGGGGAGAC
ATGCTGCTGCCCTTTACCGCAGGCACCTTTATCTACGTGGGCACCGTGGCCGCGATTCCAGAGCTGCTCGAGAAT
AGGCCAGGGCAGAGCAAGACGGAGGCGATTCGGGGTGCGGCGGCGCAGTTTGCGGCCATGGCCATGGGAGCAGCC
ATCATGCTGTACATTTCGTGGCACAGCTGA
Gene >OphauB2|4214
ATGAGCCTCGCAGCCATTGAAGCGGAGCTGCAGGTCAGGAGGAGCCCAAGGCAGCGGGTGGGAAAGAAAGCTGAC
GGGCGTTGAACTGGAATTGCAGACGTGTGAGATTGTGCAGCAGCTCAAGGCGGCACGGACAGAGACGGCAGGCCA
CGAGCCATCGTGGTCGACACAGCGACTGTTTGGCATGCTCTTTCCCAGCTCCCACGCAGGCATCAACGCATTGCT
GGCCACGGCGTACATTTCAGGCCCTCCGAATCTGCTGCTGGCCTTGTGTCCGACCAAGTTGGATGCCGGGCTGCT
AGGCACCATGGTGGCCTTTGCCGTGGGCGGGCTGCTTGGCGATGCCTTTTTCCACCTGCTGCCCGAGATATTCCT
GGGCGAGGGCGAGGACCACGGCGCGGCGCGGTTTGTGCTTGTTGAGCCCAATAGGAATCTCTTGCTCGGTCTCGG
AGTTCTCTTTGGCTTTGTCATTTTTGTTGCTCTGGACAAGGGCATGCGCATCGCGACTGGAGGGGCGCACAGCCA
TGGACACGAGGGGCATGGCGACGACGGCAGCGAGGACGAAGCAGTGGCCGAGACAACAGGGGCGCAGACGGCAGA
CGGAGCGATGCGGCTGAGGAAGAGCAAGGCAAAGAACACGGCAGTAGCTAGAGTGCAAGAGGACAAGGCTGACAA
GCACGACAAGACGAGTCTGAAGCTGGGTGGCTATCTAAATCTAGTGTTAGCTTTGCACAGAACTACATGGACCGC
CATCATGAACCGGCGTACTGACTAGTTTGCAGAGCCGACTTTACGCACAACGTGACGGATGGGCTGGCCATGGCT
GCCAGCTTCTACGCTTCACCAACAGTGGGCGCCACCACGGCCGTTGCAGTCTTCATGCACGAGATTCCACACGAG
GTGGGCGACTTTGCTCTGCTGGTGCAGTCGGGCTTCTCCAAGCGAGCGGCCATGGCGTCGCAGTTTGTCACGGCC
CTGGGCGCTCTGCTGGGCACCTTGATTGGCATTGCAGTGCAGGAGCTGGGCGGGCAGGGCGGCCGAGGAGGCGAC
GACATGGCTCGAAACGAGGGCATCTGGGGAACCAGTCTTGTAAGCAGCAGAGCAACTGGAAGTCTGTCTTGTTGG
TGCTTTGAGGCTAACATGCAGTCTCCTCTCTTTTTTTCTTGGCGTCTGCTCCTCGACAGAGCTGGGGAGACATGC
TGCTGCCCTTTACCGCAGGCACCTTTATCTACGTGGGCACCGTGGCCGCGATTCCAGAGCTGCTCGAGAATAGGC
CAGGGCAGAGCAAGACGGAGGCGATTCGGGGTGCGGCGGCGCAGTTTGCGGCCATGGCCATGGGAGCAGCCATCA
TGCTGTACATTTCGTGGCACAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail