Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4213
Gene name
LocationContig_28:72897..74614
Strand+
Gene length (bp)1717
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17 8.6E-08 177 285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 7 314 2.0E-118
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 9 314 2.0E-115
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 22 312 9.0E-114
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 22 312 5.0E-113
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 22 312 6.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 7 314 2.0E-118
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 9 314 2.0E-115
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 22 312 9.0E-114
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 22 312 5.0E-113
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 22 312 6.0E-113
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 19 323 1.0E-111
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 1 312 1.0E-108
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 23 272 8.0E-16
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 6 272 6.0E-13
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 6 272 3.0E-12
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 175 264 1.0E-09
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 4 272 4.0E-09
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 24 314 9.0E-07
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 179 264 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4213
MPCSALVLALAAAVSSASAAFQGFNYGSSFTDGRPKARSDFEAEFKAAAGLAGTNGGFQSARLFTMIQEGSANDP
ISAIPAAINTKTSLLFGMWCSGGDAAFNNELAALRTTTQQYCGQLDGLVAGISVGSEDLYRISPTGQKNSPDPGA
APMTLVKYIKQVRDATKGTCLEKVPIGHVDTWTAYVNDTNKPVIDALDWVGMDAYPYFEDTKPNSLAQGKSLFES
ALEATRGAAGGKDVWITETGWPVSGNMFGAAVPSRDNAKVYWDEVGCPRFGKVNIWWYTLQDGAPAVPNPSFGIV
GSQLGTAPLYDLSCGGTGSNNSSTGGSSTVVPGSQSTGTASGMYPTPSSGAGTGTGSGTGAGSGTGSGSGTGAGS
GAGAGSGSDACTGVDCAECPEPGSDANPGSGAGSGSGTGSGAGAGACSGAGNETCSGSGSSPGAGAGAGTGVGST
PGSTPGSSPGSAPGSPPGSTPGSAPGSGACSGAGTGPCPGSGVGSGPSNSTGPAGGAGSGPNAGGVGSSPGSVQV
PQGSGSQLNSLGAAAVALVLAVALL*
Coding >OphauB2|4213
ATGCCTTGCTCGGCTCTTGTCCTGGCATTGGCGGCGGCTGTGTCGTCTGCCAGTGCTGCCTTTCAGGGCTTCAAC
TATGGCTCCTCGTTTACCGACGGACGGCCCAAGGCTCGGTCGGATTTCGAGGCCGAGTTCAAGGCTGCGGCGGGA
CTTGCCGGGACAAATGGCGGCTTCCAAAGTGCTCGCCTCTTCACCATGATTCAAGAGGGCTCTGCCAATGATCCC
ATTTCGGCCATTCCCGCCGCCATTAATACCAAGACGAGCCTGCTGTTTGGCATGTGGTGCTCGGGTGGTGACGCT
GCGTTTAATAACGAGCTTGCGGCCCTTCGTACCACTACGCAGCAGTATTGCGGCCAGCTCGATGGTCTTGTTGCC
GGCATCTCAGTCGGCAGTGAGGACCTCTACCGCATCTCACCCACGGGCCAAAAGAATAGTCCTGATCCAGGCGCC
GCCCCCATGACTCTTGTCAAGTATATCAAGCAGGTTCGTGATGCCACCAAGGGCACTTGTCTCGAAAAGGTGCCC
ATTGGACATGTCGATACTTGGACCGCCTATGTCAATGACACGAATAAGCCCGTCATTGACGCCCTTGACTGGGTC
GGCATGGACGCTTATCCATACTTTGAAGACACCAAGCCCAATAGCCTCGCCCAAGGCAAGAGCCTCTTTGAGTCT
GCTCTTGAAGCCACGCGCGGCGCCGCCGGCGGCAAGGACGTTTGGATTACCGAGACTGGCTGGCCTGTTAGTGGA
AACATGTTTGGCGCCGCGGTGCCGTCTAGGGATAATGCAAAGGTTTATTGGGACGAGGTGGGATGCCCCCGCTTT
GGCAAGGTGAATATTTGGTGGTATACGCTTCAGGATGGTGCGCCTGCTGTGCCGAATCCGAGCTTTGGCATTGTT
GGCTCGCAGCTTGGCACGGCGCCGCTCTATGATCTCTCGTGCGGCGGTACGGGCTCGAATAATTCTTCGACTGGC
GGCTCGTCGACTGTTGTGCCGGGTTCACAGAGTACAGGCACGGCTTCTGGAATGTACCCTACTCCTAGCTCTGGT
GCTGGCACTGGCACTGGCTCTGGTACGGGTGCTGGCTCTGGTACTGGCTCTGGCTCTGGTACGGGTGCTGGCTCT
GGTGCTGGTGCTGGCTCTGGCTCTGATGCCTGCACCGGAGTCGACTGCGCCGAATGCCCCGAGCCTGGCTCCGAT
GCAAACCCTGGGTCTGGTGCTGGATCCGGCTCTGGTACCGGTTCCGGAGCCGGTGCTGGTGCTTGCTCTGGCGCA
GGCAATGAAACCTGCTCTGGCTCTGGGTCCAGTCCCGGTGCCGGTGCCGGTGCTGGTACCGGTGTCGGCTCGACC
CCGGGATCCACTCCGGGCTCGTCTCCGGGTTCGGCTCCAGGCTCGCCTCCAGGCTCGACTCCGGGCTCGGCTCCG
GGCTCAGGTGCTTGCTCTGGAGCTGGTACGGGCCCATGCCCCGGCTCCGGAGTTGGCTCTGGACCCAGCAACTCT
ACTGGTCCAGCGGGTGGCGCAGGTTCCGGGCCCAATGCTGGTGGCGTTGGAAGCTCGCCCGGTTCCGTGCAAGTG
CCTCAGGGTAGCGGCAGCCAGCTCAACTCGCTTGGTGCTGCTGCTGTCGCTCTTGTGCTGGCTGTTGCTCTCTTG
TAA
Transcript >OphauB2|4213
ATGCCTTGCTCGGCTCTTGTCCTGGCATTGGCGGCGGCTGTGTCGTCTGCCAGTGCTGCCTTTCAGGGCTTCAAC
TATGGCTCCTCGTTTACCGACGGACGGCCCAAGGCTCGGTCGGATTTCGAGGCCGAGTTCAAGGCTGCGGCGGGA
CTTGCCGGGACAAATGGCGGCTTCCAAAGTGCTCGCCTCTTCACCATGATTCAAGAGGGCTCTGCCAATGATCCC
ATTTCGGCCATTCCCGCCGCCATTAATACCAAGACGAGCCTGCTGTTTGGCATGTGGTGCTCGGGTGGTGACGCT
GCGTTTAATAACGAGCTTGCGGCCCTTCGTACCACTACGCAGCAGTATTGCGGCCAGCTCGATGGTCTTGTTGCC
GGCATCTCAGTCGGCAGTGAGGACCTCTACCGCATCTCACCCACGGGCCAAAAGAATAGTCCTGATCCAGGCGCC
GCCCCCATGACTCTTGTCAAGTATATCAAGCAGGTTCGTGATGCCACCAAGGGCACTTGTCTCGAAAAGGTGCCC
ATTGGACATGTCGATACTTGGACCGCCTATGTCAATGACACGAATAAGCCCGTCATTGACGCCCTTGACTGGGTC
GGCATGGACGCTTATCCATACTTTGAAGACACCAAGCCCAATAGCCTCGCCCAAGGCAAGAGCCTCTTTGAGTCT
GCTCTTGAAGCCACGCGCGGCGCCGCCGGCGGCAAGGACGTTTGGATTACCGAGACTGGCTGGCCTGTTAGTGGA
AACATGTTTGGCGCCGCGGTGCCGTCTAGGGATAATGCAAAGGTTTATTGGGACGAGGTGGGATGCCCCCGCTTT
GGCAAGGTGAATATTTGGTGGTATACGCTTCAGGATGGTGCGCCTGCTGTGCCGAATCCGAGCTTTGGCATTGTT
GGCTCGCAGCTTGGCACGGCGCCGCTCTATGATCTCTCGTGCGGCGGTACGGGCTCGAATAATTCTTCGACTGGC
GGCTCGTCGACTGTTGTGCCGGGTTCACAGAGTACAGGCACGGCTTCTGGAATGTACCCTACTCCTAGCTCTGGT
GCTGGCACTGGCACTGGCTCTGGTACGGGTGCTGGCTCTGGTACTGGCTCTGGCTCTGGTACGGGTGCTGGCTCT
GGTGCTGGTGCTGGCTCTGGCTCTGATGCCTGCACCGGAGTCGACTGCGCCGAATGCCCCGAGCCTGGCTCCGAT
GCAAACCCTGGGTCTGGTGCTGGATCCGGCTCTGGTACCGGTTCCGGAGCCGGTGCTGGTGCTTGCTCTGGCGCA
GGCAATGAAACCTGCTCTGGCTCTGGGTCCAGTCCCGGTGCCGGTGCCGGTGCTGGTACCGGTGTCGGCTCGACC
CCGGGATCCACTCCGGGCTCGTCTCCGGGTTCGGCTCCAGGCTCGCCTCCAGGCTCGACTCCGGGCTCGGCTCCG
GGCTCAGGTGCTTGCTCTGGAGCTGGTACGGGCCCATGCCCCGGCTCCGGAGTTGGCTCTGGACCCAGCAACTCT
ACTGGTCCAGCGGGTGGCGCAGGTTCCGGGCCCAATGCTGGTGGCGTTGGAAGCTCGCCCGGTTCCGTGCAAGTG
CCTCAGGGTAGCGGCAGCCAGCTCAACTCGCTTGGTGCTGCTGCTGTCGCTCTTGTGCTGGCTGTTGCTCTCTTG
TAA
Gene >OphauB2|4213
ATGCCTTGCTCGGCTCTTGTCCTGGCATTGGCGGCGGCTGTGTCGTCTGCCAGTGCTGCCTTTCAGGGCTTCAAC
TATGGCTCCTCGTTTACCGACGGACGGCCCAAGGCTCGGTCGGATTTCGAGGCCGAGTTCAAGGCTGCGGCGGGA
CTTGCCGGGACAAATGGCGGCTTCCAAAGTGCTCGCCTCTTCACCATGATTGTACGTTGTAGCCGGTTTTGTTTC
CTTGTTGTTCTTGTTTATTGACGGCCTTGTTGTGCTGCAGCAAGAGGGCTCTGCCAATGATCCCATTTCGGCCAT
TCCCGCCGCCATTAATACCAAGACGAGCCTGCTGTTTGGCATGTGGTGCTCGGGTGGTGACGCTGCGTTTAATAA
CGAGCTTGCGGCCCTTCGTACCACTACGCAGCAGTATTGCGGCCAGCTCGATGGTCTTGTTGCCGGCATCTCAGT
CGGCAGTGAGGACCTCTACCGCATCTCACCCACGGGCCAAAAGAATAGTCCTGATCCAGGCGCCGCCCCCATGAC
TCTTGTCAAGTATATCAAGCAGGTTCGTGATGCCACCAAGGGCACTTGTCTCGAAAAGGTGCCCATTGGACATGT
CGATACTTGGACCGCCTATGTCAATGACACGAATAAGCCCGTCATTGACGCCCTTGACTGGGTCGGCATGGACGC
TTATCCATACTTTGAAGACACCAAGCCCAATAGCCTCGCCCAAGGCAAGAGCCTCTTTGAGTCTGCTCTTGAAGC
CACGCGCGGCGCCGCCGGCGGCAAGGACGTTTGGATTACCGAGACTGGCTGGCCTGTTAGTGGAAACATGTTTGG
CGCCGCGGTGCCGTCTAGGGATAATGCAAAGGTTTATTGGGACGAGGTGGGATGCCCCCGCTTTGGCAAGGTGAA
TATTTGGTGGTATACGCTTCAGGATGGTGCGCCTGCTGTGCCGAATCCGAGCTTTGGCATTGTTGGCTCGCAGCT
TGGCACGGCGCCGCTCTATGATCTCTCGTGCGGCGGTACGGGCTCGAATAATTCTTCGACTGGCGGCTCGTCGAC
TGTTGTGCCGGGTTCACAGAGTACAGGCACGGCTTCTGGAATGTACCCTACTCCTAGCTCTGGTGCTGGCACTGG
CACTGGCTCTGGTACGGGTGCTGGCTCTGGTACTGGCTCTGGCTCTGGTACGGGTGCTGGCTCTGGTGCTGGTGC
TGGCTCTGGCTCTGATGCCTGCACCGGAGTCGACTGCGCCGAATGCCCCGAGCCTGGCTCCGATGCAAACCCTGG
GTCTGGTGCTGGATCCGGCTCTGGTACCGGTTCCGGAGCCGGTGCTGGTGCTTGCTCTGGCGCAGGCAATGAAAC
CTGCTCTGGCTCTGGGTCCAGTCCCGGTGCCGGTGCCGGTGCTGGTACCGGTGTCGGCTCGACCCCGGGATCCAC
TCCGGGCTCGTCTCCGGGTTCGGCTCCAGGCTCGCCTCCAGGCTCGACTCCGGGCTCGGCTCCGGGCTCAGGTGC
TTGCTCTGGAGCTGGTACGGGCCCATGCCCCGGCTCCGGAGTTGGCTCTGGACCCAGCAACTCTACTGGTCCAGC
GGGTGGCGCAGGTTCCGGGCCCAATGCTGGTGGCGTTGGAAGCTCGCCCGGTTCCGTGCAAGTGCCTCAGGGTAG
CGGCAGCCAGCTCAACTCGCTTGGTGCTGCTGCTGTCGCTCTTGTGCTGGCTGTTGCTCTCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail