Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4206
Gene name
LocationContig_28:54936..56458
Strand+
Gene length (bp)1522
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-15 51 119
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.6E-11 233 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEQ9|TCG1_SCHPO Single-stranded TG1-3 DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tcg1 PE=1 SV=3 43 325 8.0E-28
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 46 323 1.0E-08
sp|Q6FVV7|RRT5_CANGA Regulator of rDNA transcription protein 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRT5 PE=3 SV=1 50 319 2.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 219 323 4.0E-08
sp|A7TQR2|RRT5_VANPO Regulator of rDNA transcription protein 5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRT5 PE=3 SV=1 41 322 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEQ9|TCG1_SCHPO Single-stranded TG1-3 DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tcg1 PE=1 SV=3 43 325 8.0E-28
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 46 323 1.0E-08
sp|Q6FVV7|RRT5_CANGA Regulator of rDNA transcription protein 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRT5 PE=3 SV=1 50 319 2.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 219 323 4.0E-08
sp|A7TQR2|RRT5_VANPO Regulator of rDNA transcription protein 5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRT5 PE=3 SV=1 41 322 5.0E-08
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 46 323 7.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 228 319 8.0E-08
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 50 146 3.0E-07
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 51 138 3.0E-07
sp|Q08170|SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens GN=SRSF4 PE=1 SV=2 50 142 4.0E-07
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 51 125 6.0E-07
sp|P26686|SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster GN=B52 PE=1 SV=4 48 125 1.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 232 319 2.0E-06
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 42 141 3.0E-06
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 24 124 3.0E-06
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 46 121 4.0E-06
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 52 142 6.0E-06
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 51 128 6.0E-06
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 50 124 7.0E-06
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 40 125 7.0E-06
sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 50 127 7.0E-06
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 51 125 8.0E-06
sp|Q80YR5|SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus musculus GN=Safb2 PE=1 SV=2 14 125 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4206
MSATTVDNKTSEAAVNDLTSALRNTSISSPANDKAAANEAASASAAEGRRLYIGNLAYATKEEELKDFFKGYLVE
SVSIPKNPRTERPVGYAFVDLSTPSEAERAIAQLSGQEILERKVSVQLARKPEASGEKSEGANGEGVGAEGSRRR
PSGRGRGRGRGRGGRGGARGGRTGETSDDYKDGEAMDPATTDAAAASIGGEGTTENHKNQNRPLRERRERGPPAD
GIPSKIKVMVANLPYDLTEEKLIELFKAYEPSSAKIALRPIPRFMIKKLQARGEPRKGRGFGFVTLASEELQQKA
VAEMNGKEIEGREIAVKVAIDSPDKTDDDNGPAQGENENVNVEETPATASAAA*
Coding >OphauB2|4206
ATGTCTGCTACTACTGTGGACAACAAGACGTCCGAGGCCGCCGTCAATGACCTCACATCTGCTCTGCGCAACACG
TCAATCAGCTCGCCTGCCAACGACAAGGCCGCCGCCAATGAAGCTGCTTCGGCCAGCGCGGCTGAGGGCCGTCGC
CTCTACATTGGCAACTTGGCCTATGCGACAAAGGAGGAAGAATTGAAGGACTTTTTCAAGGGTTATCTTGTAGAG
TCTGTTTCGATTCCAAAAAACCCTCGCACCGAGCGCCCCGTTGGCTACGCCTTTGTCGATCTGTCTACTCCTTCA
GAGGCAGAGCGTGCAATTGCACAGCTCTCGGGCCAAGAAATTCTCGAGCGCAAAGTCTCAGTTCAGCTGGCTCGC
AAGCCCGAGGCTTCTGGTGAAAAGTCTGAGGGTGCCAACGGTGAGGGTGTTGGTGCCGAGGGCTCGCGTCGCCGT
CCCTCTGGTCGTGGCCGTGGCCGCGGTCGTGGTCGGGGCGGTCGAGGTGGCGCTCGTGGCGGCCGAACTGGCGAA
ACAAGCGATGACTACAAGGACGGCGAGGCTATGGATCCTGCCACGACTGATGCCGCAGCCGCCTCTATTGGCGGT
GAAGGCACCACTGAGAACCACAAGAACCAGAACCGGCCCCTACGTGAACGCCGAGAGCGTGGTCCTCCCGCGGAC
GGAATTCCCTCCAAGATTAAGGTCATGGTTGCCAACCTACCGTATGACCTTACCGAGGAAAAGCTTATTGAGCTG
TTCAAGGCATACGAGCCTTCCTCGGCCAAGATTGCCCTGCGGCCAATTCCTCGATTCATGATCAAGAAGCTCCAA
GCCCGTGGCGAGCCCCGCAAGGGACGTGGATTTGGATTTGTCACCTTGGCATCGGAGGAACTTCAGCAAAAGGCC
GTTGCTGAGATGAACGGAAAGGAGATTGAAGGTCGTGAAATTGCCGTCAAGGTGGCGATTGATAGCCCGGACAAG
ACAGACGACGACAATGGCCCCGCTCAGGGCGAAAATGAGAATGTCAACGTCGAGGAGACGCCTGCCACGGCCAGT
GCCGCTGCCTAG
Transcript >OphauB2|4206
ATGTCTGCTACTACTGTGGACAACAAGACGTCCGAGGCCGCCGTCAATGACCTCACATCTGCTCTGCGCAACACG
TCAATCAGCTCGCCTGCCAACGACAAGGCCGCCGCCAATGAAGCTGCTTCGGCCAGCGCGGCTGAGGGCCGTCGC
CTCTACATTGGCAACTTGGCCTATGCGACAAAGGAGGAAGAATTGAAGGACTTTTTCAAGGGTTATCTTGTAGAG
TCTGTTTCGATTCCAAAAAACCCTCGCACCGAGCGCCCCGTTGGCTACGCCTTTGTCGATCTGTCTACTCCTTCA
GAGGCAGAGCGTGCAATTGCACAGCTCTCGGGCCAAGAAATTCTCGAGCGCAAAGTCTCAGTTCAGCTGGCTCGC
AAGCCCGAGGCTTCTGGTGAAAAGTCTGAGGGTGCCAACGGTGAGGGTGTTGGTGCCGAGGGCTCGCGTCGCCGT
CCCTCTGGTCGTGGCCGTGGCCGCGGTCGTGGTCGGGGCGGTCGAGGTGGCGCTCGTGGCGGCCGAACTGGCGAA
ACAAGCGATGACTACAAGGACGGCGAGGCTATGGATCCTGCCACGACTGATGCCGCAGCCGCCTCTATTGGCGGT
GAAGGCACCACTGAGAACCACAAGAACCAGAACCGGCCCCTACGTGAACGCCGAGAGCGTGGTCCTCCCGCGGAC
GGAATTCCCTCCAAGATTAAGGTCATGGTTGCCAACCTACCGTATGACCTTACCGAGGAAAAGCTTATTGAGCTG
TTCAAGGCATACGAGCCTTCCTCGGCCAAGATTGCCCTGCGGCCAATTCCTCGATTCATGATCAAGAAGCTCCAA
GCCCGTGGCGAGCCCCGCAAGGGACGTGGATTTGGATTTGTCACCTTGGCATCGGAGGAACTTCAGCAAAAGGCC
GTTGCTGAGATGAACGGAAAGGAGATTGAAGGTCGTGAAATTGCCGTCAAGGTGGCGATTGATAGCCCGGACAAG
ACAGACGACGACAATGGCCCCGCTCAGGGCGAAAATGAGAATGTCAACGTCGAGGAGACGCCTGCCACGGCCAGT
GCCGCTGCCTAG
Gene >OphauB2|4206
ATGTCTGCTACTACTGTGGACAACAAGACGTCCGAGGCCGCCGTCAATGACCTCACATCTGCTCTGCGCAACACG
TCAATCAGCTCGCCTGCCAACGACAAGGCCGCCGCCAATGAAGCTGCTTCGGCCAGCGCGGCTGAGGGCCGTCGC
CTCTACATTGGCAACTTGGCCTATGCGACAAAGGAGGAAGAATTGAAGGACTTTTTCAAGGGTTATCTTGTGTAA
GTTTTCTCTGTCATCTCCCTTTATCTTCCGGCCTCGATTTCCGCTTGGTCATTGTTTGGTTCTTTGTTTTGCTCC
TTCAAGTTTTGCCACGCTGCATTGCAATGTGCGCTTGCTTCTTGTTGCCCTCCAAGAGACGCATGTGGCGCTTTG
TTGATGCTGGCAATGCTTTCATCATTTTCTTTTGTTGCTACGTCTATTTGTCATTCAAGCTGCCAATCCTGGCGC
TCAAGGCTTTGATTGTCTTTTTTTTTTGAATCCTGGCTGCTAACTTTCAATAGAGAGTCTGTTTCGATTCCAAAA
AACCCTCGCACCGAGCGCCCCGTTGGCTACGCCTTTGTCGATCTGTCTACTCCTTCAGAGGCAGAGCGTGCAATT
GCACAGCTCTCGGGCCAAGAAATTCTCGAGCGCAAAGTCTCAGTTCAGCTGGCTCGCAAGCCCGAGGCTTCTGGT
GAAAAGTCTGAGGGTGCCAACGGTGAGGGTGTTGGTGCCGAGGGCTCGCGTCGCCGTCCCTCTGGTCGTGGCCGT
GGCCGCGGTCGTGGTCGGGGCGGTCGAGGTGGCGCTCGTGGCGGCCGAACTGGCGTATGTGCTTGACCAAGTTGG
CTCTTTTGAAGTTTGAGTGGCTAATACACTTCGTTTCTAGGAAACAAGCGATGACTACAAGGACGGCGAGGCTAT
GGATCCTGCCACGACTGATGCCGCAGCCGCCTCTATTGGCGGTGAAGGCACCACTGAGGTGCTCCCACTACAGGA
TATTACCAACGAGACCAAGACTGACGACAATGCCAAGAACCACAAGAACCAGAACCGGCCCCTACGTGAACGCCG
AGAGCGTGGTCCTCCCGCGGACGGAATTCCCTCCAAGATTAAGGTCATGGTTGCCAACCTACCGTATGACCTTAC
CGAGGAAAAGGTGAGCAAGCCAAGTCCACGAGTAGTGTTGCCTGAGCATGGCTAACTAACTGTTGATGCTCAGCT
TATTGAGCTGTTCAAGGCATACGAGCCTTCCTCGGCCAAGATTGCCCTGCGGCCAATTCCTCGATTCATGATCAA
GAAGCTCCAAGCCCGTGGCGAGCCCCGCAAGGGACGTGGATTTGGATTTGTCACCTTGGCATCGGAGGAACTTCA
GCAAAAGGCCGTTGCTGAGATGAACGGAAAGGAGATTGAAGGTCGTGAAATTGCCGTCAAGGTGGCGATTGATAG
CCCGGACAAGACAGACGACGACAATGGCCCCGCTCAGGGCGAAAATGAGAATGTCAACGTCGAGGAGACGCCTGC
CACGGCCAGTGCCGCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail