Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4195
Gene name
LocationContig_28:16020..17859
Strand-
Gene length (bp)1839
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05920 Homeobox_KN Homeobox KN domain 1.1E-15 235 274
PF00046 Homeodomain Homeodomain 5.4E-06 224 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86IH1|HBX4_DICDI Homeobox protein 4 OS=Dictyostelium discoideum GN=hbx4 PE=3 SV=1 208 274 6.0E-14
sp|Q38897|BEL1_ARATH Homeobox protein BEL1 homolog OS=Arabidopsis thaliana GN=BEL1 PE=1 SV=2 82 274 4.0E-10
sp|Q8SRR1|HD12_ENCCU Homeobox protein HD-12 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-12 PE=3 SV=1 224 274 5.0E-10
sp|A8WL06|UNC62_CAEBR Homeobox protein unc-62 OS=Caenorhabditis briggsae GN=unc-62 PE=3 SV=2 219 274 3.0E-09
sp|Q6NVN3|IRX3_XENTR Iroquois-class homeodomain protein irx-3 OS=Xenopus tropicalis GN=irx3 PE=2 SV=1 225 293 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86IH1|HBX4_DICDI Homeobox protein 4 OS=Dictyostelium discoideum GN=hbx4 PE=3 SV=1 208 274 6.0E-14
sp|Q38897|BEL1_ARATH Homeobox protein BEL1 homolog OS=Arabidopsis thaliana GN=BEL1 PE=1 SV=2 82 274 4.0E-10
sp|Q8SRR1|HD12_ENCCU Homeobox protein HD-12 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-12 PE=3 SV=1 224 274 5.0E-10
sp|A8WL06|UNC62_CAEBR Homeobox protein unc-62 OS=Caenorhabditis briggsae GN=unc-62 PE=3 SV=2 219 274 3.0E-09
sp|Q6NVN3|IRX3_XENTR Iroquois-class homeodomain protein irx-3 OS=Xenopus tropicalis GN=irx3 PE=2 SV=1 225 293 3.0E-09
sp|O42261|IRX3_XENLA Iroquois-class homeodomain protein irx-3 OS=Xenopus laevis GN=irx3 PE=2 SV=2 225 293 4.0E-09
sp|Q9N5D6|UNC62_CAEEL Homeobox protein unc-62 OS=Caenorhabditis elegans GN=unc-62 PE=1 SV=1 219 274 4.0E-09
sp|P78415|IRX3_HUMAN Iroquois-class homeodomain protein IRX-3 OS=Homo sapiens GN=IRX3 PE=2 SV=3 225 293 4.0E-09
sp|P81067|IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 OS=Mus musculus GN=Irx3 PE=1 SV=2 225 292 7.0E-09
sp|Q8SR09|HD2_ENCCU Homeobox protein HD-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-2 PE=3 SV=1 216 274 9.0E-09
sp|Q93348|IRX_CAEEL Putative iroquois-class homeodomain protein irx-1 OS=Caenorhabditis elegans GN=irx-1 PE=3 SV=3 225 295 1.0E-08
sp|Q54VB4|HBX9_DICDI Homeobox protein 9 OS=Dictyostelium discoideum GN=hbx9 PE=3 SV=1 214 274 1.0E-08
sp|P70284|TGIF1_MOUSE Homeobox protein TGIF1 OS=Mus musculus GN=Tgif1 PE=1 SV=2 186 274 2.0E-08
sp|Q9SIW1|BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana GN=BLH7 PE=2 SV=1 228 338 3.0E-08
sp|Q9SW80|BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana GN=BLH2 PE=1 SV=3 228 274 3.0E-08
sp|Q8MIE6|TF2LX_HYLLA Homeobox protein TGIF2LX OS=Hylobates lar GN=TGIF2LX PE=2 SV=1 227 274 4.0E-08
sp|Q90655|AKR_CHICK Homeobox protein AKR OS=Gallus gallus PE=2 SV=1 224 274 4.0E-08
sp|Q8IUE1|TF2LX_HUMAN Homeobox protein TGIF2LX OS=Homo sapiens GN=TGIF2LX PE=1 SV=1 180 292 5.0E-08
sp|Q8MIE9|TF2LX_GORGO Homeobox protein TGIF2LX OS=Gorilla gorilla gorilla GN=TGIF2LX PE=2 SV=1 227 292 5.0E-08
sp|Q5IS58|TGIF1_PANTR Homeobox protein TGIF1 OS=Pan troglodytes GN=TGIF1 PE=2 SV=1 186 274 5.0E-08
sp|P97367|MEIS2_MOUSE Homeobox protein Meis2 OS=Mus musculus GN=Meis2 PE=1 SV=2 224 274 5.0E-08
sp|O14770|MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens GN=MEIS2 PE=1 SV=2 224 274 5.0E-08
sp|Q15583|TGIF1_HUMAN Homeobox protein TGIF1 OS=Homo sapiens GN=TGIF1 PE=1 SV=3 186 274 6.0E-08
sp|Q6DIF3|MEIS3_XENTR Homeobox protein meis3 OS=Xenopus tropicalis GN=meis3 PE=2 SV=2 224 274 6.0E-08
sp|Q5U4X3|MEI3A_XENLA Homeobox protein meis3-A OS=Xenopus laevis GN=meis3-a PE=2 SV=1 224 274 6.0E-08
sp|Q7ZY13|MEI3B_XENLA Homeobox protein meis3-B OS=Xenopus laevis GN=meis3-b PE=2 SV=2 224 274 6.0E-08
sp|Q9HDS5|MTAL2_KLULA Mating-type protein ALPHA2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HMLALPHA2 PE=3 SV=1 219 289 8.0E-08
sp|Q8MIB7|TF2LX_PANTR Homeobox protein TGIF2LX OS=Pan troglodytes GN=TGIF2LX PE=2 SV=2 180 274 8.0E-08
sp|A1YGI6|TF2LX_PANPA Homeobox protein TGIF2LX OS=Pan paniscus GN=TGIF2LX PE=3 SV=1 193 274 8.0E-08
sp|Q8MID1|TF2LX_MIOTA Homeobox protein TGIF2LX OS=Miopithecus talapoin GN=TGIF2LX PE=2 SV=1 193 292 8.0E-08
sp|Q8S897|BLH5_ARATH BEL1-like homeodomain protein 5 OS=Arabidopsis thaliana GN=BLH5 PE=1 SV=2 227 274 9.0E-08
sp|Q8IUE0|TF2LY_HUMAN Homeobox protein TGIF2LY OS=Homo sapiens GN=TGIF2LY PE=1 SV=1 193 292 1.0E-07
sp|Q99687|MEIS3_HUMAN Homeobox protein Meis3 OS=Homo sapiens GN=MEIS3 PE=2 SV=3 224 274 1.0E-07
sp|Q86Z42|MTAL2_CANGA Mating-type-like protein ALPHA2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MTL1ALPHA2 PE=2 SV=1 221 276 1.0E-07
sp|O70477|PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus GN=Pknox1 PE=1 SV=3 224 316 1.0E-07
sp|P79937|MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis GN=meis1 PE=1 SV=1 224 274 1.0E-07
sp|A6NDR6|ME3L1_HUMAN Putative homeobox protein Meis3-like 1 OS=Homo sapiens GN=MEIS3P1 PE=5 SV=2 224 274 1.0E-07
sp|Q60954|MEIS1_MOUSE Homeobox protein Meis1 OS=Mus musculus GN=Meis1 PE=1 SV=1 224 274 1.0E-07
sp|O00470|MEIS1_HUMAN Homeobox protein Meis1 OS=Homo sapiens GN=MEIS1 PE=1 SV=1 224 274 1.0E-07
sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabidopsis thaliana GN=BLH11 PE=2 SV=1 228 274 1.0E-07
sp|Q870I4|MTL32_CANGA Mating-type-like protein ALPHA2, silenced copy at MTL3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MTL3alpha2 PE=3 SV=1 221 276 1.0E-07
sp|Q8C0Y1|TGIF2_MOUSE Homeobox protein TGIF2 OS=Mus musculus GN=Tgif2 PE=2 SV=1 224 274 1.0E-07
sp|P54269|CAUP_DROME Homeobox protein caupolican OS=Drosophila melanogaster GN=caup PE=2 SV=2 225 278 1.0E-07
sp|Q9GZN2|TGIF2_HUMAN Homeobox protein TGIF2 OS=Homo sapiens GN=TGIF2 PE=1 SV=1 224 274 1.0E-07
sp|P97368|MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus GN=Meis3 PE=2 SV=2 224 274 1.0E-07
sp|Q9FXG8|BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana GN=BLH10 PE=1 SV=1 228 274 1.0E-07
sp|Q94KL5|BLH4_ARATH BEL1-like homeodomain protein 4 OS=Arabidopsis thaliana GN=BLH4 PE=1 SV=2 228 274 1.0E-07
sp|O46339|HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster GN=hth PE=1 SV=1 224 274 2.0E-07
sp|Q8MID6|TF2LX_MACMU Homeobox protein TGIF2LX OS=Macaca mulatta GN=TGIF2LX PE=2 SV=1 227 292 2.0E-07
sp|Q8MID8|TF2LX_MACFA Homeobox protein TGIF2LX OS=Macaca fascicularis GN=TGIF2LX PE=2 SV=1 227 292 2.0E-07
sp|P41817|CUP9_YEAST Homeobox protein CUP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP9 PE=1 SV=1 226 274 2.0E-07
sp|Q874N1|MTAL2_KLUDE Mating-type protein ALPHA2 OS=Kluyveromyces delphensis GN=MATALPHA2 PE=3 SV=1 221 276 2.0E-07
sp|Q24248|ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster GN=ara PE=1 SV=2 204 278 2.0E-07
sp|A8K0S8|ME3L2_HUMAN Putative homeobox protein Meis3-like 2 OS=Homo sapiens GN=MEIS3P2 PE=2 SV=1 224 274 2.0E-07
sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis thaliana GN=BLH9 PE=1 SV=1 228 274 2.0E-07
sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana GN=BLH1 PE=1 SV=1 228 274 2.0E-07
sp|O65685|BLH6_ARATH BEL1-like homeodomain protein 6 OS=Arabidopsis thaliana GN=BLH6 PE=1 SV=1 228 274 2.0E-07
sp|Q9FWS9|BLH3_ARATH BEL1-like homeodomain protein 3 OS=Arabidopsis thaliana GN=BLH3 PE=1 SV=1 228 274 2.0E-07
sp|P78414|IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 OS=Homo sapiens GN=IRX1 PE=2 SV=3 225 301 2.0E-07
sp|P56660|KNOX2_MAIZE Homeobox protein knotted-1-like 2 (Fragment) OS=Zea mays GN=KNOX2 PE=2 SV=1 227 274 2.0E-07
sp|P81068|IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 OS=Mus musculus GN=Irx1 PE=1 SV=4 225 278 3.0E-07
sp|P0CY12|MATA2_YEASX Putative mating-type protein A2 OS=Saccharomyces cerevisiae GN=MATA2 PE=3 SV=1 221 276 3.0E-07
sp|P0CY13|HMRA2_YEAST Silenced mating-type protein A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMRA2 PE=3 SV=1 221 276 3.0E-07
sp|P56667|KNX10_MAIZE Homeobox protein knotted-1-like 10 (Fragment) OS=Zea mays GN=KNOX10 PE=3 SV=1 215 279 4.0E-07
sp|P78413|IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens GN=IRX4 PE=1 SV=2 225 278 4.0E-07
sp|Q9QY61|IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 OS=Mus musculus GN=Irx4 PE=2 SV=1 225 278 4.0E-07
sp|Q2TAQ8|IRX1B_XENLA Iroquois-class homeodomain protein irx-1-B OS=Xenopus laevis GN=irx1-b PE=2 SV=1 225 278 4.0E-07
sp|Q6F2E3|IRX1_XENTR Iroquois-class homeodomain protein irx-1 OS=Xenopus tropicalis GN=irx1 PE=2 SV=1 225 278 5.0E-07
sp|Q9SJJ3|BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana GN=BLH8 PE=1 SV=1 228 274 5.0E-07
sp|P78412|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens GN=IRX6 PE=2 SV=3 225 278 5.0E-07
sp|Q8MIB8|TF2LX_PONPY Homeobox protein TGIF2LX OS=Pongo pygmaeus GN=TGIF2LX PE=2 SV=1 227 274 5.0E-07
sp|P81066|IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus GN=Irx2 PE=2 SV=2 225 284 5.0E-07
sp|Q9BZI1|IRX2_HUMAN Iroquois-class homeodomain protein IRX-2 OS=Homo sapiens GN=IRX2 PE=1 SV=2 225 284 6.0E-07
sp|Q9YGK8|IRX1A_XENLA Iroquois-class homeodomain protein irx-1-A OS=Xenopus laevis GN=irx1-a PE=2 SV=1 225 278 6.0E-07
sp|Q8MIC2|TF2LX_PAPHA Homeobox protein TGIF2LX OS=Papio hamadryas GN=TGIF2LX PE=2 SV=1 193 274 7.0E-07
sp|Q9YGS0|IRX4_CHICK Iroquois-class homeodomain protein IRX-4 OS=Gallus gallus GN=IRX4 PE=2 SV=1 225 278 7.0E-07
sp|Q66IK1|IRX2_XENTR Iroquois-class homeodomain protein irx-2 OS=Xenopus tropicalis GN=irx2 PE=2 SV=1 225 284 9.0E-07
sp|Q9BYU1|PBX4_HUMAN Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens GN=PBX4 PE=1 SV=2 211 276 9.0E-07
sp|P53147|TOS8_YEAST Homeobox protein TOS8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS8 PE=3 SV=1 226 274 1.0E-06
sp|P48731|ATH1_ARATH Homeobox protein ATH1 OS=Arabidopsis thaliana GN=ATH1 PE=1 SV=1 227 274 1.0E-06
sp|Q6DCQ1|IRX2_XENLA Iroquois-class homeodomain protein irx-2 OS=Xenopus laevis GN=irx2 PE=2 SV=1 225 284 1.0E-06
sp|Q688D0|IRX4_XENTR Iroquois-class homeodomain protein irx-4 OS=Xenopus tropicalis GN=irx4 PE=2 SV=1 225 278 1.0E-06
sp|Q2HJ84|PKNX1_BOVIN Homeobox protein PKNOX1 OS=Bos taurus GN=PKNOX1 PE=2 SV=1 224 316 1.0E-06
sp|B7ZRT8|IRX4B_XENLA Iroquois-class homeodomain protein irx-4-B OS=Xenopus laevis GN=irx4-b PE=2 SV=1 225 278 1.0E-06
sp|Q90XW6|IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis GN=irx4-a PE=2 SV=1 225 276 1.0E-06
sp|Q9ER75|IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 OS=Mus musculus GN=Irx6 PE=2 SV=2 225 278 1.0E-06
sp|P55347|PKNX1_HUMAN Homeobox protein PKNOX1 OS=Homo sapiens GN=PKNOX1 PE=1 SV=3 224 316 2.0E-06
sp|P78411|IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 OS=Homo sapiens GN=IRX5 PE=1 SV=3 225 278 2.0E-06
sp|Q90XW5|IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis GN=irx5 PE=2 SV=1 225 278 2.0E-06
sp|Q9JKQ4|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus GN=Irx5 PE=2 SV=1 225 278 2.0E-06
sp|Q75LX9|KNOS5_ORYSJ Putative homeobox protein knotted-1-like 5 OS=Oryza sativa subsp. japonica GN=Os03g0673500 PE=3 SV=1 226 274 2.0E-06
sp|P56659|KNOX1_MAIZE Homeobox protein knotted-1-like 1 (Fragment) OS=Zea mays GN=KNOX1 PE=2 SV=1 227 274 2.0E-06
sp|P56665|KNOX7_MAIZE Homeobox protein knotted-1-like 7 (Fragment) OS=Zea mays GN=KNOX7 PE=2 SV=1 227 274 2.0E-06
sp|P56664|KNOX6_MAIZE Homeobox protein knotted-1-like 6 (Fragment) OS=Zea mays GN=KNOX6 PE=2 SV=1 227 274 2.0E-06
sp|P46640|KNAT2_ARATH Homeobox protein knotted-1-like 2 OS=Arabidopsis thaliana GN=KNAT2 PE=1 SV=3 226 274 2.0E-06
sp|Q4LDQ3|IRX5_XENTR Iroquois-class homeodomain protein irx-5 OS=Xenopus tropicalis GN=irx5 PE=2 SV=1 225 278 2.0E-06
sp|P56661|KNOX3_MAIZE Homeobox protein knotted-1-like 3 (Fragment) OS=Zea mays GN=KNOX3 PE=2 SV=1 227 274 3.0E-06
sp|P0CY08|MTAL2_YEAST Mating-type protein ALPHA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MATALPHA2 PE=1 SV=1 221 276 3.0E-06
sp|P0CY09|HMAL2_YEAST Silenced mating-type protein ALPHA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMLALPHA2 PE=3 SV=1 221 276 3.0E-06
sp|Q5R6L1|PKNX2_PONAB Homeobox protein PKNOX2 OS=Pongo abelii GN=PKNOX2 PE=2 SV=1 224 274 4.0E-06
sp|Q96KN3|PKNX2_HUMAN Homeobox protein PKNOX2 OS=Homo sapiens GN=PKNOX2 PE=2 SV=2 224 274 5.0E-06
sp|P56662|KNOX4_MAIZE Homeobox protein knotted-1-like 4 (Fragment) OS=Zea mays GN=KNOX4 PE=2 SV=1 227 274 5.0E-06
sp|Q8BG99|PKNX2_MOUSE Homeobox protein PKNOX2 OS=Mus musculus GN=Pknox2 PE=2 SV=1 224 274 5.0E-06
sp|Q0J6N4|KNOSD_ORYSJ Homeobox protein knotted-1-like 13 OS=Oryza sativa subsp. japonica GN=OSH45 PE=2 SV=2 222 284 5.0E-06
sp|P56666|KNOX8_MAIZE Homeobox protein knotted-1-like 8 (Fragment) OS=Zea mays GN=KNOX8 PE=2 SV=1 227 274 5.0E-06
sp|P48001|KNAT4_ARATH Homeobox protein knotted-1-like 4 OS=Arabidopsis thaliana GN=KNAT4 PE=1 SV=3 227 284 8.0E-06
sp|Q94LW4|KNOSB_ORYSJ Homeobox protein knotted-1-like 11 OS=Oryza sativa subsp. japonica GN=HOS59 PE=2 SV=2 231 274 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Homeodomain

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4195
MTTIHEMDELVNWDETKVCVETAIGIPVPASASARSQHHSALAGLSDATASARPNSSSLFLHQGSDHGFDTLYAL
QSFHQHPPSHPSSDLHLSMDGTAALDLLENLDSPCFNCAFGGYSCKKIREGRHTGYCTSCVALGLECSSGSSMLA
TASAIYAASLWPAMPHGSAVNVVAHDEVLAGQGYGQTGSGFAAAANTPHLDKAVTDCDVAAAMALAPAKIGARFS
RESVRTLKNWLTSHNRHPYPSDEEKEALQRQTGLNKTQITNWLANARRRGKVQAPRSTSPHVGNMSGSACIDIPQ
RRNTPALEAMNPLQRWQYSPPEHEPASVAAIARAVTASSSCVLSSCLNSPYSLHYTTDDASSRSLCNQSSASSLG
TSQTSNGSHGSAYSHASRNSLASFGSTPFSVRGHRRRRRRATPQLDSESSTCATTPLKTFQCTFCTETFRTKHDW
QRHEKSLHLSLERWICAPHGPRALSQENGQLCCVFCGLANPSDAHLDSHNHTACQERSLEERTFYRKDHLNQHLR
LVHNVKFLDWSMKQWKVATPEIRSRCGFCGIVMDTWTFRVDHLADHFKTGYSMADWKGDWGFDVPVLDMVENSIP
PCTRPLLNSSRD*
Coding >OphauB2|4195
ATGACCACCATTCACGAAATGGACGAGCTGGTCAATTGGGACGAGACCAAGGTCTGTGTTGAAACAGCCATTGGC
ATCCCCGTCCCTGCCTCTGCCAGCGCTCGAAGTCAGCATCACTCGGCTCTGGCAGGCCTGTCCGATGCCACGGCC
AGTGCTCGCCCCAACTCCAGCAGTCTCTTCTTGCACCAAGGCTCGGACCATGGCTTTGACACGTTGTACGCCCTG
CAATCCTTTCATCAGCATCCCCCGTCTCACCCCTCGAGCGACTTGCATCTCTCCATGGATGGCACCGCTGCTCTT
GATTTGCTGGAAAATCTCGACTCGCCCTGCTTCAACTGTGCCTTTGGCGGCTATTCGTGCAAGAAGATACGCGAG
GGCCGCCACACGGGCTACTGCACCAGCTGTGTTGCTCTGGGCCTCGAGTGTAGTTCGGGCTCGAGCATGCTGGCC
ACCGCCTCAGCCATCTATGCCGCTTCCTTGTGGCCTGCCATGCCCCATGGCTCTGCAGTCAACGTTGTAGCCCAT
GACGAGGTGCTTGCCGGACAGGGCTATGGCCAGACTGGCTCAGGCTTTGCTGCCGCTGCCAACACGCCTCACTTG
GACAAGGCGGTCACAGACTGCGACGTGGCTGCTGCCATGGCTCTTGCGCCCGCCAAGATTGGCGCCCGCTTCTCG
CGAGAGTCGGTTCGCACTCTCAAGAACTGGCTCACGTCGCACAACCGCCACCCCTACCCCAGTGACGAAGAGAAG
GAGGCCCTCCAGCGCCAGACGGGCCTCAACAAGACCCAAATCACTAATTGGCTTGCAAATGCCCGCCGCCGCGGC
AAGGTACAGGCCCCTCGCTCAACGTCGCCGCACGTTGGAAACATGTCTGGCTCTGCTTGTATCGACATTCCCCAG
AGACGGAACACTCCAGCCCTCGAAGCTATGAATCCCCTGCAGCGCTGGCAATACTCTCCGCCAGAGCACGAGCCG
GCTTCTGTCGCGGCCATTGCCCGTGCTGTCACGGCCTCGTCATCATGCGTCTTGTCCTCGTGCCTCAACAGCCCC
TATAGCCTCCACTATACCACAGACGATGCGTCCAGCAGGTCTCTTTGTAACCAGTCCTCTGCTAGCAGCCTGGGA
ACTTCGCAAACGAGCAATGGCTCTCATGGTTCTGCATACTCTCACGCCTCTCGAAACTCTTTGGCCTCGTTTGGC
TCTACTCCATTCAGTGTCAGGGGCCACCGTCGACGCCGACGAAGGGCCACTCCCCAGCTCGACAGCGAGTCGAGC
ACCTGCGCAACAACACCGCTCAAGACTTTTCAGTGCACTTTTTGCACCGAGACTTTTCGTACCAAGCACGACTGG
CAGCGCCACGAAAAATCGTTGCATCTTTCCTTGGAGCGCTGGATTTGTGCACCGCACGGCCCGCGCGCCCTCAGC
CAGGAAAATGGCCAGCTGTGCTGCGTTTTTTGTGGCTTGGCTAACCCTAGCGATGCACACTTGGACAGCCACAAC
CACACGGCTTGTCAGGAGCGGTCACTGGAGGAGCGCACCTTTTATCGCAAGGACCATTTGAACCAGCATCTCAGA
CTGGTGCATAATGTTAAATTTCTCGACTGGTCCATGAAACAATGGAAGGTGGCGACTCCAGAAATCCGATCACGG
TGTGGCTTTTGCGGAATCGTTATGGATACGTGGACCTTTCGAGTTGATCACTTGGCCGACCACTTCAAGACGGGT
TATTCCATGGCCGACTGGAAGGGCGATTGGGGTTTCGACGTGCCAGTTCTTGACATGGTGGAGAACTCGATTCCT
CCTTGTACGAGGCCTTTGCTGAATTCGTCTCGGGACTAA
Transcript >OphauB2|4195
ATGACCACCATTCACGAAATGGACGAGCTGGTCAATTGGGACGAGACCAAGGTCTGTGTTGAAACAGCCATTGGC
ATCCCCGTCCCTGCCTCTGCCAGCGCTCGAAGTCAGCATCACTCGGCTCTGGCAGGCCTGTCCGATGCCACGGCC
AGTGCTCGCCCCAACTCCAGCAGTCTCTTCTTGCACCAAGGCTCGGACCATGGCTTTGACACGTTGTACGCCCTG
CAATCCTTTCATCAGCATCCCCCGTCTCACCCCTCGAGCGACTTGCATCTCTCCATGGATGGCACCGCTGCTCTT
GATTTGCTGGAAAATCTCGACTCGCCCTGCTTCAACTGTGCCTTTGGCGGCTATTCGTGCAAGAAGATACGCGAG
GGCCGCCACACGGGCTACTGCACCAGCTGTGTTGCTCTGGGCCTCGAGTGTAGTTCGGGCTCGAGCATGCTGGCC
ACCGCCTCAGCCATCTATGCCGCTTCCTTGTGGCCTGCCATGCCCCATGGCTCTGCAGTCAACGTTGTAGCCCAT
GACGAGGTGCTTGCCGGACAGGGCTATGGCCAGACTGGCTCAGGCTTTGCTGCCGCTGCCAACACGCCTCACTTG
GACAAGGCGGTCACAGACTGCGACGTGGCTGCTGCCATGGCTCTTGCGCCCGCCAAGATTGGCGCCCGCTTCTCG
CGAGAGTCGGTTCGCACTCTCAAGAACTGGCTCACGTCGCACAACCGCCACCCCTACCCCAGTGACGAAGAGAAG
GAGGCCCTCCAGCGCCAGACGGGCCTCAACAAGACCCAAATCACTAATTGGCTTGCAAATGCCCGCCGCCGCGGC
AAGGTACAGGCCCCTCGCTCAACGTCGCCGCACGTTGGAAACATGTCTGGCTCTGCTTGTATCGACATTCCCCAG
AGACGGAACACTCCAGCCCTCGAAGCTATGAATCCCCTGCAGCGCTGGCAATACTCTCCGCCAGAGCACGAGCCG
GCTTCTGTCGCGGCCATTGCCCGTGCTGTCACGGCCTCGTCATCATGCGTCTTGTCCTCGTGCCTCAACAGCCCC
TATAGCCTCCACTATACCACAGACGATGCGTCCAGCAGGTCTCTTTGTAACCAGTCCTCTGCTAGCAGCCTGGGA
ACTTCGCAAACGAGCAATGGCTCTCATGGTTCTGCATACTCTCACGCCTCTCGAAACTCTTTGGCCTCGTTTGGC
TCTACTCCATTCAGTGTCAGGGGCCACCGTCGACGCCGACGAAGGGCCACTCCCCAGCTCGACAGCGAGTCGAGC
ACCTGCGCAACAACACCGCTCAAGACTTTTCAGTGCACTTTTTGCACCGAGACTTTTCGTACCAAGCACGACTGG
CAGCGCCACGAAAAATCGTTGCATCTTTCCTTGGAGCGCTGGATTTGTGCACCGCACGGCCCGCGCGCCCTCAGC
CAGGAAAATGGCCAGCTGTGCTGCGTTTTTTGTGGCTTGGCTAACCCTAGCGATGCACACTTGGACAGCCACAAC
CACACGGCTTGTCAGGAGCGGTCACTGGAGGAGCGCACCTTTTATCGCAAGGACCATTTGAACCAGCATCTCAGA
CTGGTGCATAATGTTAAATTTCTCGACTGGTCCATGAAACAATGGAAGGTGGCGACTCCAGAAATCCGATCACGG
TGTGGCTTTTGCGGAATCGTTATGGATACGTGGACCTTTCGAGTTGATCACTTGGCCGACCACTTCAAGACGGGT
TATTCCATGGCCGACTGGAAGGGCGATTGGGGTTTCGACGTGCCAGTTCTTGACATGGTGGAGAACTCGATTCCT
CCTTGTACGAGGCCTTTGCTGAATTCGTCTCGGGACTAA
Gene >OphauB2|4195
ATGACCACCATTCACGAAATGGACGAGCTGGTCAATTGGGACGAGACCAAGGTCTGTGTTGAAACAGCCATTGGC
ATCCCCGTCCCTGCCTCTGCCAGCGCTCGAAGTCAGCATCACTCGGCTCTGGCAGGCCTGTCCGATGCCACGGCC
AGTGCTCGCCCCAACTCCAGCAGTCTCTTCTTGCACCAAGGCTCGGACCATGGCTTTGACACGTTGTACGCCCTG
CAATCCTTTCATCAGCATCCCCCGTCTCACCCCTCGAGCGACTTGCATCTCTCCATGGATGGCACCGCTGCTCTT
GATTTGCTGGAAAATCTCGACTCGCCCTGCTTCAACTGTGCCTTTGGCGGCTATTCGTGCAAGAAGATACGCGAG
GGCCGCCACACGGGCTACTGCACCAGCTGTGTTGCTCTGGGCCTCGAGTGTAGTTCGGGCTCGAGCATGCTGGCC
ACCGCCTCAGCCATCTATGCCGCTTCCTTGTGGCCTGCCATGCCCCATGGCTCTGCAGTCAACGTTGTAGCCCAT
GACGAGGTGCTTGCCGGACAGGGCTATGGCCAGACTGGCTCAGGCTTTGCTGCCGCTGCCAACACGCCTCACTTG
GACAAGGCGGTCACAGACTGCGACGTGGCTGCTGCCATGGCTCTTGCGCCCGCCAAGATTGGCGCCCGCTTCTCG
CGAGAGTCGGTTCGCACTCTCAAGAACTGGCTCACGTCGCACAACCGCCACCCCTACCCCAGTGACGAAGAGAAG
GAGGCCCTCCAGCGCCAGACGGGCCTCAACAAGACCCAAATCACTAATTGGCTTGCAAATGCCCGCCGCCGCGGC
AAGGTACAGGCCCCTCGCTCAACGTCGCCGCACGTTGGAAACATGTCTGGCTCTGCTTGTATCGACATTCCCCAG
AGACGGAACACTCCAGCCCTCGAAGCTATGAATCCCCTGCAGCGCTGGCAATACTCTCCGCCAGAGCACGAGCCG
GCTTCTGTCGCGGCCATTGCCCGTGCTGTCACGGCCTCGTCATCATGCGTCTTGTCCTCGTGCCTCAACAGCCCC
TATAGCCTCCACTATACCACAGACGATGCGTCCAGCAGGTCTCTTTGTAACCAGTCCTCTGCTAGCAGCCTGGGA
ACTTCGCAAACGAGCAATGGCTCTCATGGTTCTGCATACTCTCACGCCTCTCGAAACTCTTTGGCCTCGTTTGGC
TCTACTCCATTCAGTGTCAGGGGCCACCGTCGACGCCGACGAAGGGCCACTCCCCAGCTCGACAGCGAGTCGAGC
ACCTGCGCAACAACACCGCTCAAGACTTTTCAGTGCACTTTTTGCACCGAGACTTTTCGTACCAAGCACGACTGG
CAGCGCCACGAAAAATCGTTGCATCTTTCCTTGGAGCGCTGGATTTGTGCACCGCACGGCCCGCGCGCCCTCAGC
CAGGAAAATGGCCAGCTGTGCTGCGTTTTTTGTGGCTTGGCTAACCCTAGCGATGCACACTTGGACAGCCACAAC
CACACGGCTTGTCAGGAGCGGTCACTGGAGGAGCGCACCTTTTATCGCAAGGACCATTTGAACCAGCATCTCAGA
CTGGTGCATAATGTTAAATTTCTCGACTGGTCCATGAAACAATGGAAGGTGGCGACTCCAGAAATCCGATCACGG
TGTGGCTTTTGCGGAATCGTTATGGATACGTGGACCTTTCGAGTTGATCACTTGGCCGACCACTTCAAGACGGGT
TATTCCATGGCCGACTGGAAGGGCGATTGGGGTTTCGACGTGCCAGTTCTTGACATGGTGGAGAACTCGATTCCT
CCTTGTACGAGGCCTTTGCTGAATTCGTCTCGGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail