Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4187
Gene name
LocationContig_279:6557..8169
Strand+
Gene length (bp)1612
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03348 Serinc Serine incorporator (Serinc) 1.7E-171 23 478

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMS1 PE=1 SV=1 1 480 5.0E-142
sp|Q9HDY3|YK17_SCHPO Membrane protein PB1A10.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.07c PE=3 SV=1 1 479 3.0E-106
sp|A7S4N4|SERIC_NEMVE Probable serine incorporator OS=Nematostella vectensis GN=serinc PE=3 SV=1 15 478 1.0E-81
sp|Q5R533|SERC3_PONAB Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1 9 478 6.0E-74
sp|Q13530|SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2 9 478 1.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMS1 PE=1 SV=1 1 480 5.0E-142
sp|Q9HDY3|YK17_SCHPO Membrane protein PB1A10.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.07c PE=3 SV=1 1 479 3.0E-106
sp|A7S4N4|SERIC_NEMVE Probable serine incorporator OS=Nematostella vectensis GN=serinc PE=3 SV=1 15 478 1.0E-81
sp|Q5R533|SERC3_PONAB Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1 9 478 6.0E-74
sp|Q13530|SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2 9 478 1.0E-72
sp|Q9QZI8|SERC1_MOUSE Serine incorporator 1 OS=Mus musculus GN=Serinc1 PE=1 SV=1 9 480 7.0E-71
sp|Q7TNK0|SERC1_RAT Serine incorporator 1 OS=Rattus norvegicus GN=Serinc1 PE=1 SV=1 9 480 2.0E-70
sp|Q5R419|SERC1_PONAB Serine incorporator 1 OS=Pongo abelii GN=SERINC1 PE=2 SV=1 9 480 4.0E-67
sp|Q3MHV9|SERC1_BOVIN Serine incorporator 1 OS=Bos taurus GN=SERINC1 PE=2 SV=1 9 480 6.0E-67
sp|Q9NRX5|SERC1_HUMAN Serine incorporator 1 OS=Homo sapiens GN=SERINC1 PE=1 SV=1 9 480 8.0E-67
sp|A4FUZ5|SERC3_BOVIN Serine incorporator 3 OS=Bos taurus GN=SERINC3 PE=2 SV=1 9 478 1.0E-66
sp|Q9QZI9|SERC3_MOUSE Serine incorporator 3 OS=Mus musculus GN=Serinc3 PE=1 SV=2 9 478 8.0E-55
sp|A9UY97|SERIC_MONBE Probable serine incorporator OS=Monosiga brevicollis GN=serinc PE=3 SV=1 23 478 8.0E-54
sp|Q96SA4|SERC2_HUMAN Serine incorporator 2 OS=Homo sapiens GN=SERINC2 PE=2 SV=3 17 478 5.0E-49
sp|Q54UF8|SERIC_DICDI Probable serine incorporator OS=Dictyostelium discoideum GN=serinc PE=3 SV=1 43 428 9.0E-48
sp|Q8K0E7|SERC2_MOUSE Serine incorporator 2 OS=Mus musculus GN=Serinc2 PE=2 SV=1 17 478 1.0E-47
sp|Q803X0|SERC5_DANRE Serine incorporator 5 OS=Danio rerio GN=serinc5 PE=2 SV=1 23 480 2.0E-46
sp|Q8BHJ6|SERC5_MOUSE Serine incorporator 5 OS=Mus musculus GN=Serinc5 PE=2 SV=1 23 478 9.0E-46
sp|Q58CW5|SERC2_BOVIN Serine incorporator 2 OS=Bos taurus GN=SERINC2 PE=2 SV=1 17 478 3.0E-42
sp|Q63175|SERC5_RAT Serine incorporator 5 OS=Rattus norvegicus GN=Serinc5 PE=2 SV=1 23 478 9.0E-40
sp|Q86VE9|SERC5_HUMAN Serine incorporator 5 OS=Homo sapiens GN=SERINC5 PE=2 SV=1 23 437 3.0E-39
sp|Q4R6L9|SERC5_MACFA Serine incorporator 5 OS=Macaca fascicularis GN=SERINC5 PE=2 SV=1 51 478 2.0E-37
sp|A6NH21|SERC4_HUMAN Serine incorporator 4 OS=Homo sapiens GN=SERINC4 PE=2 SV=1 21 461 6.0E-32
sp|Q5XK03|SERC4_MOUSE Serine incorporator 4 OS=Mus musculus GN=Serinc4 PE=2 SV=1 23 461 4.0E-29
sp|A8WCG0|SERC4_RAT Serine incorporator 4 OS=Rattus norvegicus GN=Serinc4 PE=2 SV=2 24 461 1.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 97 119 22
4 132 151 19
5 161 183 22
6 204 226 22
7 236 258 22
8 265 287 22
9 302 321 19
10 407 429 22
11 449 471 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4187
MGALLSLPLLAVPSMGAIISCAASCCGAATCSMVCSACGKCGNSVATRIAYALMLLVNSIVAWIMLTPWAIEKLQ
HLMLDYVRINCPTGQCYGWLAVHRINFALGLLHIILAGLLFGVSSSKNPRAAIQNGYWGPKIIAWIALIVVAFLI
PDQFFLFYGNYISLVCAMLFLILGLVLLVDLAHNWAEYCLAQIDNSDSRLWRFILIGSTLSMYLASIAMTVVQYV
FFAGPHCSMNQAVITINLLLWIAISLASVNPTVQEHNPRAGLAQAAMVAVYCTYLTMSAVSMEPDDKRCNPLIRA
QGTRTTSVILGAVVTMLTVAYTTTRAATQSLGLGSKHGSIRLPDDDDVADEHGLVTQQPSSRREMRAEALRRAVE
QGSLPANALLSDDSDSEHDAPSQDDERSSTQYNYSMFHIIFFLATTWVATLLTLNYDDSVKSDGGFATVGRTYAA
SWLKIASAWVCHALYIWSLAAPVIYPDRFDLS*
Coding >OphauB2|4187
ATGGGCGCCCTACTATCGCTGCCTCTGCTCGCAGTACCCAGCATGGGTGCGATTATTTCGTGTGCTGCCAGTTGT
TGCGGCGCGGCTACATGTTCCATGGTGTGCAGCGCCTGTGGGAAATGCGGCAACAGTGTCGCCACTCGCATCGCC
TACGCCTTGATGCTTCTTGTCAACTCGATTGTTGCTTGGATCATGCTCACGCCGTGGGCTATTGAAAAACTGCAG
CATCTTATGCTCGACTATGTCCGCATCAACTGTCCGACGGGCCAGTGCTATGGCTGGCTTGCCGTGCATCGCATC
AACTTTGCCCTCGGCCTCTTACACATTATACTCGCCGGGCTGCTCTTTGGCGTCTCGTCGTCAAAGAACCCACGC
GCTGCTATTCAAAACGGCTACTGGGGTCCCAAAATTATTGCCTGGATTGCGCTTATTGTCGTCGCCTTTCTTATT
CCCGATCAGTTTTTCCTCTTTTACGGCAACTACATTTCTCTGGTTTGCGCCATGCTCTTTCTCATTCTCGGCCTC
GTGCTCCTTGTCGACCTGGCTCACAACTGGGCGGAATACTGCCTTGCCCAGATTGACAACTCAGACTCGAGACTA
TGGCGCTTCATCCTTATTGGGTCCACGCTCTCCATGTACCTGGCATCCATCGCCATGACGGTGGTTCAGTACGTC
TTCTTTGCCGGGCCTCATTGCTCGATGAATCAAGCCGTCATTACCATTAATTTGCTGCTCTGGATCGCCATTTCA
CTGGCGTCGGTCAACCCAACGGTTCAAGAGCACAACCCCCGTGCTGGCTTGGCCCAAGCCGCCATGGTTGCCGTC
TACTGCACCTATCTCACCATGTCGGCCGTGTCGATGGAGCCTGATGATAAGCGGTGTAATCCTCTTATCCGCGCT
CAAGGCACCCGCACCACGTCGGTCATTCTTGGCGCCGTGGTGACCATGCTGACTGTGGCTTACACGACGACTCGC
GCCGCTACACAGAGCCTGGGGCTGGGCTCCAAGCATGGGTCCATTCGTCTGCCCGATGACGACGACGTTGCCGAC
GAGCATGGCCTCGTTACACAGCAGCCCAGCAGTCGGCGTGAGATGCGGGCCGAAGCGCTGCGACGTGCCGTTGAG
CAAGGCAGCTTGCCTGCCAATGCTCTCTTGTCGGATGACTCTGATTCGGAGCACGACGCTCCCTCCCAGGACGAT
GAGCGATCCAGTACTCAGTACAATTACTCCATGTTTCACATCATCTTCTTCTTGGCCACCACGTGGGTCGCCACT
CTCTTGACCTTGAATTACGACGATTCTGTAAAGTCTGACGGCGGCTTTGCTACTGTTGGCCGCACCTACGCCGCC
AGCTGGCTAAAAATTGCAAGTGCTTGGGTCTGTCATGCTCTCTACATTTGGAGTCTAGCTGCCCCTGTCATCTAT
CCCGATCGTTTTGACCTTTCTTGA
Transcript >OphauB2|4187
ATGGGCGCCCTACTATCGCTGCCTCTGCTCGCAGTACCCAGCATGGGTGCGATTATTTCGTGTGCTGCCAGTTGT
TGCGGCGCGGCTACATGTTCCATGGTGTGCAGCGCCTGTGGGAAATGCGGCAACAGTGTCGCCACTCGCATCGCC
TACGCCTTGATGCTTCTTGTCAACTCGATTGTTGCTTGGATCATGCTCACGCCGTGGGCTATTGAAAAACTGCAG
CATCTTATGCTCGACTATGTCCGCATCAACTGTCCGACGGGCCAGTGCTATGGCTGGCTTGCCGTGCATCGCATC
AACTTTGCCCTCGGCCTCTTACACATTATACTCGCCGGGCTGCTCTTTGGCGTCTCGTCGTCAAAGAACCCACGC
GCTGCTATTCAAAACGGCTACTGGGGTCCCAAAATTATTGCCTGGATTGCGCTTATTGTCGTCGCCTTTCTTATT
CCCGATCAGTTTTTCCTCTTTTACGGCAACTACATTTCTCTGGTTTGCGCCATGCTCTTTCTCATTCTCGGCCTC
GTGCTCCTTGTCGACCTGGCTCACAACTGGGCGGAATACTGCCTTGCCCAGATTGACAACTCAGACTCGAGACTA
TGGCGCTTCATCCTTATTGGGTCCACGCTCTCCATGTACCTGGCATCCATCGCCATGACGGTGGTTCAGTACGTC
TTCTTTGCCGGGCCTCATTGCTCGATGAATCAAGCCGTCATTACCATTAATTTGCTGCTCTGGATCGCCATTTCA
CTGGCGTCGGTCAACCCAACGGTTCAAGAGCACAACCCCCGTGCTGGCTTGGCCCAAGCCGCCATGGTTGCCGTC
TACTGCACCTATCTCACCATGTCGGCCGTGTCGATGGAGCCTGATGATAAGCGGTGTAATCCTCTTATCCGCGCT
CAAGGCACCCGCACCACGTCGGTCATTCTTGGCGCCGTGGTGACCATGCTGACTGTGGCTTACACGACGACTCGC
GCCGCTACACAGAGCCTGGGGCTGGGCTCCAAGCATGGGTCCATTCGTCTGCCCGATGACGACGACGTTGCCGAC
GAGCATGGCCTCGTTACACAGCAGCCCAGCAGTCGGCGTGAGATGCGGGCCGAAGCGCTGCGACGTGCCGTTGAG
CAAGGCAGCTTGCCTGCCAATGCTCTCTTGTCGGATGACTCTGATTCGGAGCACGACGCTCCCTCCCAGGACGAT
GAGCGATCCAGTACTCAGTACAATTACTCCATGTTTCACATCATCTTCTTCTTGGCCACCACGTGGGTCGCCACT
CTCTTGACCTTGAATTACGACGATTCTGTAAAGTCTGACGGCGGCTTTGCTACTGTTGGCCGCACCTACGCCGCC
AGCTGGCTAAAAATTGCAAGTGCTTGGGTCTGTCATGCTCTCTACATTTGGAGTCTAGCTGCCCCTGTCATCTAT
CCCGATCGTTTTGACCTTTCTTGA
Gene >OphauB2|4187
ATGGGCGCCCTACTATCGCTGCCTCTGCTCGCAGTACCCAGCATGGGTGCGGTACGTTGCTCAGACCGGACGCCG
ACGAAACCAAGCTCGCGATTTTATTTTTTTTGGGGGTTCGCCTTTGGCTGACTAGGCGTGTTGCTTTGGTAGATT
ATTTCGTGTGCTGCCAGTTGTTGCGGCGCGGCTACATGTTCCATGGTGTGCAGCGCCTGTGGGAAATGCGGCAAC
AGGCACGTTTATGTATTCTTGGTGGCGGTGGGCAAGGGGTTTCGGGCATGGTAGCTGACGGGTTTATAGTGTCGC
CACTCGCATCGCCTACGCCTTGATGCTTCTTGTCAACTCGATTGTTGCTTGGATCATGCTCACGCCGTGGGCTAT
TGAAAAACTGCAGCATCTTATGCTCGACTATGTCCGCATCAACTGTCCGACGGGCCAGTGCTATGGCTGGCTTGC
CGTGCATCGCATCAACTTTGCCCTCGGCCTCTTACACATTATACTCGCCGGGCTGCTCTTTGGCGTCTCGTCGTC
AAAGAACCCACGCGCTGCTATTCAAAACGGCTACTGGGGTCCCAAAATTATTGCCTGGATTGCGCTTATTGTCGT
CGCCTTTCTTATTCCCGATCAGTTTTTCCTCTTTTACGGCAACTACATTTCTCTGGTTTGCGCCATGCTCTTTCT
CATTCTCGGCCTCGTGCTCCTTGTCGACCTGGCTCACAACTGGGCGGAATACTGCCTTGCCCAGATTGACAACTC
AGACTCGAGACTATGGCGCTTCATCCTTATTGGGTCCACGCTCTCCATGTACCTGGCATCCATCGCCATGACGGT
GGTTCAGTACGTCTTCTTTGCCGGGCCTCATTGCTCGATGAATCAAGCCGTCATTACCATTAATTTGCTGCTCTG
GATCGCCATTTCACTGGCGTCGGTCAACCCAACGGTTCAAGAGCACAACCCCCGTGCTGGCTTGGCCCAAGCCGC
CATGGTTGCCGTCTACTGCACCTATCTCACCATGTCGGCCGTGTCGATGGAGCCTGATGATAAGCGGTGTAATCC
TCTTATCCGCGCTCAAGGCACCCGCACCACGTCGGTCATTCTTGGCGCCGTGGTGACCATGCTGACTGTGGCTTA
CACGACGACTCGCGCCGCTACACAGAGCCTGGGGCTGGGCTCCAAGCATGGGTCCATTCGTCTGCCCGATGACGA
CGACGTTGCCGACGAGCATGGCCTCGTTACACAGCAGCCCAGCAGTCGGCGTGAGATGCGGGCCGAAGCGCTGCG
ACGTGCCGTTGAGCAAGGCAGCTTGCCTGCCAATGCTCTCTTGTCGGATGACTCTGATTCGGAGCACGACGCTCC
CTCCCAGGACGATGAGCGATCCAGTACTCAGTACAATTACTCCATGTTTCACATCATCTTCTTCTTGGCCACCAC
GTGGGTCGCCACTCTCTTGACCTTGAATTACGACGATTCTGTAAAGTCTGACGGCGGCTTTGCTACTGTTGGCCG
CACCTACGCCGCCAGCTGGCTAAAAATTGCAAGTGCTTGGGTCTGTCATGCTCTCTACATTTGGAGTCTAGCTGC
CCCTGTCATCTATCCCGATCGTTTTGACCTTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail