Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4186
Gene name
LocationContig_279:4359..6035
Strand-
Gene length (bp)1676
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-13 18 285
PF06813 Nodulin-like Nodulin-like 1.3E-09 12 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 13 470 6.0E-37
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 2 456 9.0E-31
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 6 456 9.0E-26
sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mch1 PE=3 SV=2 1 470 3.0E-21
sp|Q96TW9|MCH1_WICAO Probable transporter MCH1 OS=Wickerhamomyces anomalus GN=MCH1 PE=3 SV=1 4 431 9.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 13 470 6.0E-37
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 2 456 9.0E-31
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 6 456 9.0E-26
sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mch1 PE=3 SV=2 1 470 3.0E-21
sp|Q96TW9|MCH1_WICAO Probable transporter MCH1 OS=Wickerhamomyces anomalus GN=MCH1 PE=3 SV=1 4 431 9.0E-18
sp|Q6BN11|MCH1_DEBHA Probable transporter MCH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCH1 PE=3 SV=2 19 432 5.0E-17
sp|Q59MJ2|MCH1_CANAL Probable transporter MCH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCH1 PE=3 SV=1 4 482 9.0E-15
sp|Q6CGU8|MCH1_YARLI Probable transporter MCH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCH1 PE=3 SV=1 18 458 9.0E-15
sp|Q6FWD4|MCH1_CANGA Probable transporter MCH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCH1 PE=3 SV=1 28 477 2.0E-14
sp|Q6CPY8|MCH1_KLULA Probable transporter MCH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCH1 PE=3 SV=1 18 481 1.0E-11
sp|Q4WVT3|MCH1_ASPFU Probable transporter mch1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mch1 PE=3 SV=1 7 169 6.0E-08
sp|Q07376|MCH1_YEAST Probable transporter MCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH1 PE=1 SV=1 231 431 6.0E-08
sp|Q4WVT3|MCH1_ASPFU Probable transporter mch1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mch1 PE=3 SV=1 263 470 2.0E-07
sp|Q752I1|MCH1_ASHGO Probable transporter MCH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCH1 PE=3 SV=1 28 467 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 77 94 17
4 115 137 22
5 152 174 22
6 181 203 22
7 269 291 22
8 346 368 22
9 373 395 22
10 408 430 22
11 453 470 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4186
MHKRHARLVASAAATVISLACGTNYVYSAWAPQFAERLRLSATQSNVIGLSGNLGMYLLGVPVGVLVDRRGPRPF
VLTGAMLLFVGYFCLYRAYQDTSTSGLRSSSVPASGSSSILALAFCSFLSGLGSCMAFAAAVKTSALNWPANRGT
ATAFPLAAFGLSAFFFSSLGALVFPGHPGAFLRLLAYGTLLLIALGFFFLNVHPHDMSPQALMRPVLEEPGTSTP
GRGSVDETSSLVSSSSGAQGSLLEARVDQPLDVRGMRLLRSHSFWLLFSIMALLAGVGLMTINNIGNNVNVLWRH
RDPSVTRDFLVQRQQMHVSIISICSFVARLVSGVGSDYMVSIHVSRLWCLVAACLIFVTAQVCALSIHDPHLLSL
VSILSGLGYGFLFGVFPSLVSEAFGIRGFSQNWGFITLAPVVSSNAFNIFYGFVYDKHSVIEPNGQRSCHDGLAC
YRAAYWVTLGACSAVFLIILRTFRHERLQYARLSKRLPD*
Coding >OphauB2|4186
ATGCACAAACGCCATGCCCGACTTGTTGCCAGCGCTGCTGCCACGGTGATTTCCCTGGCCTGCGGCACAAACTAC
GTCTACTCTGCATGGGCGCCGCAATTCGCTGAGCGGCTGCGCCTCTCGGCAACCCAGAGCAATGTTATCGGCTTG
AGCGGCAACTTGGGCATGTATCTGCTGGGCGTGCCCGTCGGAGTCTTGGTTGATCGCCGAGGACCGCGCCCCTTT
GTTCTCACGGGTGCCATGTTGCTCTTTGTCGGCTACTTTTGCTTGTACCGCGCATATCAGGACACCAGCACATCT
GGCTTGCGCTCCAGCTCGGTCCCTGCCTCGGGCTCCAGCTCCATCCTCGCTCTCGCATTCTGCTCCTTTCTCTCT
GGCCTCGGAAGCTGCATGGCCTTTGCCGCCGCCGTCAAGACTTCGGCTCTCAACTGGCCTGCCAATCGCGGCACC
GCCACCGCATTCCCCCTCGCTGCCTTTGGCCTCAGCGCCTTCTTCTTCTCCTCGCTTGGCGCCCTCGTCTTTCCT
GGTCACCCGGGCGCCTTTTTGCGCCTTCTCGCCTATGGCACCTTGCTTCTCATAGCCCTTGGCTTTTTCTTCCTC
AACGTACACCCACATGACATGTCTCCCCAAGCCCTGATGCGACCAGTCTTGGAAGAGCCTGGTACGTCGACGCCC
GGCCGTGGGAGCGTAGACGAGACGTCTTCTCTCGTCTCGTCTTCGTCTGGCGCTCAAGGCAGCCTCTTGGAGGCT
CGTGTTGATCAACCCCTAGATGTCCGTGGAATGCGTCTCCTTCGCTCCCATTCTTTTTGGCTGCTCTTCTCCATC
ATGGCCCTCCTCGCTGGTGTCGGTCTCATGACCATCAACAACATTGGCAACAATGTCAATGTCCTGTGGAGGCAT
CGCGATCCCTCCGTCACTCGGGATTTCCTCGTCCAGCGCCAGCAGATGCATGTTTCCATCATATCCATCTGTAGC
TTTGTTGCGCGTCTTGTGAGCGGTGTTGGGTCCGATTACATGGTCTCAATCCATGTCAGTCGCCTGTGGTGCCTC
GTGGCTGCCTGTCTCATCTTCGTCACCGCCCAGGTCTGCGCTCTTAGCATCCACGACCCTCACCTCTTGAGTCTA
GTCTCCATCCTCTCTGGCCTAGGCTACGGCTTTCTCTTTGGCGTCTTTCCTTCCCTTGTTAGCGAAGCGTTTGGC
ATCCGGGGCTTTAGCCAGAACTGGGGATTCATAACACTTGCGCCCGTTGTGTCCTCTAATGCATTCAACATTTTT
TACGGTTTTGTTTACGACAAGCATAGTGTCATCGAGCCCAATGGTCAGCGCTCGTGCCACGACGGCCTTGCATGC
TATCGAGCTGCTTACTGGGTTACCCTCGGTGCTTGCTCTGCCGTCTTTCTCATCATTTTGCGCACTTTTCGCCAC
GAAAGACTACAATATGCCAGGCTTAGCAAAAGGCTTCCTGACTAG
Transcript >OphauB2|4186
ATGCACAAACGCCATGCCCGACTTGTTGCCAGCGCTGCTGCCACGGTGATTTCCCTGGCCTGCGGCACAAACTAC
GTCTACTCTGCATGGGCGCCGCAATTCGCTGAGCGGCTGCGCCTCTCGGCAACCCAGAGCAATGTTATCGGCTTG
AGCGGCAACTTGGGCATGTATCTGCTGGGCGTGCCCGTCGGAGTCTTGGTTGATCGCCGAGGACCGCGCCCCTTT
GTTCTCACGGGTGCCATGTTGCTCTTTGTCGGCTACTTTTGCTTGTACCGCGCATATCAGGACACCAGCACATCT
GGCTTGCGCTCCAGCTCGGTCCCTGCCTCGGGCTCCAGCTCCATCCTCGCTCTCGCATTCTGCTCCTTTCTCTCT
GGCCTCGGAAGCTGCATGGCCTTTGCCGCCGCCGTCAAGACTTCGGCTCTCAACTGGCCTGCCAATCGCGGCACC
GCCACCGCATTCCCCCTCGCTGCCTTTGGCCTCAGCGCCTTCTTCTTCTCCTCGCTTGGCGCCCTCGTCTTTCCT
GGTCACCCGGGCGCCTTTTTGCGCCTTCTCGCCTATGGCACCTTGCTTCTCATAGCCCTTGGCTTTTTCTTCCTC
AACGTACACCCACATGACATGTCTCCCCAAGCCCTGATGCGACCAGTCTTGGAAGAGCCTGGTACGTCGACGCCC
GGCCGTGGGAGCGTAGACGAGACGTCTTCTCTCGTCTCGTCTTCGTCTGGCGCTCAAGGCAGCCTCTTGGAGGCT
CGTGTTGATCAACCCCTAGATGTCCGTGGAATGCGTCTCCTTCGCTCCCATTCTTTTTGGCTGCTCTTCTCCATC
ATGGCCCTCCTCGCTGGTGTCGGTCTCATGACCATCAACAACATTGGCAACAATGTCAATGTCCTGTGGAGGCAT
CGCGATCCCTCCGTCACTCGGGATTTCCTCGTCCAGCGCCAGCAGATGCATGTTTCCATCATATCCATCTGTAGC
TTTGTTGCGCGTCTTGTGAGCGGTGTTGGGTCCGATTACATGGTCTCAATCCATGTCAGTCGCCTGTGGTGCCTC
GTGGCTGCCTGTCTCATCTTCGTCACCGCCCAGGTCTGCGCTCTTAGCATCCACGACCCTCACCTCTTGAGTCTA
GTCTCCATCCTCTCTGGCCTAGGCTACGGCTTTCTCTTTGGCGTCTTTCCTTCCCTTGTTAGCGAAGCGTTTGGC
ATCCGGGGCTTTAGCCAGAACTGGGGATTCATAACACTTGCGCCCGTTGTGTCCTCTAATGCATTCAACATTTTT
TACGGTTTTGTTTACGACAAGCATAGTGTCATCGAGCCCAATGGTCAGCGCTCGTGCCACGACGGCCTTGCATGC
TATCGAGCTGCTTACTGGGTTACCCTCGGTGCTTGCTCTGCCGTCTTTCTCATCATTTTGCGCACTTTTCGCCAC
GAAAGACTACAATATGCCAGGCTTAGCAAAAGGCTTCCTGACTAG
Gene >OphauB2|4186
ATGCACAAACGCCATGCCCGACTTGTTGCCAGCGCTGCTGCCACGGTGATTTCCCTGGCCTGCGGCACAAACGCA
AGTGTTGCCCGAGCCCCCCCCCCCCCCTTTATACTCCCTCTTGATGTACTAACAGCACAAGCACCAAGCAGTACG
TCTACTCTGCATGGGCGCCGCAATTCGCTGAGCGGCTGCGCCTCTCGGCAACCCAGAGCAATGTTATCGGCTTGA
GCGGCAACTTGGGCATGTATCTGCTGGGCGTGCCCGTCGGAGTCTTGGTTGATCGCCGAGGACCGCGCCCCTTTG
TTCTCACGGGTGCCATGTTGCTCTTTGTCGGCTACTTTTGCTTGTACCGCGCATATCAGGACACCAGCACATCTG
GCTTGCGCTCCAGCTCGGTCCCTGCCTCGGGCTCCAGCTCCATCCTCGCTCTCGCATTCTGCTCCTTTCTCTCTG
GCCTCGGAAGCTGCATGGCCTTTGCCGCCGCCGTCAAGACTTCGGCTCTCAACTGGCCTGCCAATCGCGGCACCG
CCACCGCATTCCCCCTCGCTGCCTTTGGCCTCAGCGCCTTCTTCTTCTCCTCGCTTGGCGCCCTCGTCTTTCCTG
GTCACCCGGGCGCCTTTTTGCGCCTTCTCGCCTATGGCACCTTGCTTCTCATAGCCCTTGGCTTTTTCTTCCTCA
ACGTACACCCACATGACATGTCTCCCCAAGCCCTGATGCGACCAGTCTTGGAAGAGCCTGGTACGTCGACGCCCG
GCCGTGGGAGCGTAGACGAGACGTCTTCTCTCGTCTCGTCTTCGTCTGGCGCTCAAGGCAGCCTCTTGGAGGCTC
GTGTTGATCAACCCCTAGATGTCCGTGGAATGCGTCTCCTTCGCTCCCATTCTTTTTGGCTGCTCTTCTCCATCA
TGGCCCTCCTCGCTGGTGTCGGTCTCATGACCATCAAGTACGCTTGTCCCTCCTCCCTCTTCTCTACCCGCTCGA
CTCCCTGTGCAATCTCTAACACGCCTGGGGCTAGCAACATTGGCAACAATGTCAATGTCCTGTGGAGGCATCGCG
ATCCCTCCGTCACTCGGGATTTCCTCGTCCAGCGCCAGCAGATGCATGTTTCCATCATATCCATCTGTAGCTTTG
TTGCGCGTCTTGTGAGCGGTAAGTTGGCGCTTGCAGGTTTCCCCCATGACAAAGGCCAGCAATGCTCAGACATGT
CAGGTGTTGGGTCCGATTACATGGTCTCAATCCATGTCAGTCGCCTGTGGTGCCTCGTGGCTGCCTGTCTCATCT
TCGTCACCGCCCAGGTCTGCGCTCTTAGCATCCACGACCCTCACCTCTTGAGTCTAGTCTCCATCCTCTCTGGCC
TAGGCTACGGCTTTCTCTTTGGCGTCTTTCCTTCCCTTGTTAGCGAAGCGTTTGGCATCCGGGGCTTTAGCCAGA
ACTGGGGATTCATAACACTTGCGCCCGTTGTGTCCTCTAATGCATTCAACATTTTTTACGGTTTTGTTTACGACA
AGCATAGTGTCATCGAGCCCAATGGTCAGCGCTCGTGCCACGACGGCCTTGCATGCTATCGAGCTGCTTACTGGG
TTACCCTCGGTGCTTGCTCTGCCGTCTTTCTCATCATTTTGCGCACTTTTCGCCACGAAAGACTACAATATGCCA
GGCTTAGCAAAAGGCTTCCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail