Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4184
Gene name
LocationContig_278:4631..8395
Strand-
Gene length (bp)3764
Transcript length (bp)3681
Coding sequence length (bp)3681
Protein length (aa) 1227

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12770 CHAT CHAT domain 1.3E-33 913 1211
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-02 140 176

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup531
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4184 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5383
Ophiocordyceps kimflemingae Ophio5|7314
Ophiocordyceps subramaniannii Hirsu2|3302
Ophiocordyceps subramaniannii Hirsu2|61
Ophiocordyceps subramaniannii Hirsu2|9455

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4184
MRALLHDMDDEELRSFAEMHQGIANDDQTELYIFTCLLLFTRTDSTDYLEQAIQRMKEMTAPIGRPDRARLLHIL
NAMSVQLRLFRLGLKSTIASQQTGLHLQVNPRNNPADKNGYIAKLTESIERTDREINTAQEDDQASLLNNLAALL
FSRFELTDSTNDLNRAINVATMAVNTTFDDMHYLVSRRFNLIRILMRRFERTNSIHDLNRIIRIADVVINTTAAG
DGYLPPTRHVLITHLIQRFNRTDSIDDCHRIIEVIALSVDADPQDYPVRASLVHWLGIRFERTGSKDDLNRAFQI
IEATVEDASKDHGRADMWSNIAPRLEARYERTNSVDELNHLSDTLTKAVEANIRRNVHRLRPLNALMLCLYKKAE
RTGVVDKLDFAIEAAMTAVEATEQGIPYRNDTLHVLAISLRLRFDRTNSTDDLNLAIDYAIMAVGASKDDYQHPN
LRQLALSNLTICLWKRFDRIGTIDDLDHAIDVASQAVDSASQDNSSRATCLESLAFCLDSRFMLIRSIQDINSAI
DHFKMAIEMTPPDSFDRFRILNALALCLNSRFEYNGSMEDFNEAVTHLTTVVNTHPSSDANHAIYLANLGVLHGK
HFDETDSMTDINRAVELITLALDTTPQQVPERATRLNNLGIFLHKRSMRTDSIDDADRALSLHQEGWRCHSGLPN
IRMHSAKNGAMILASQSRWPESNKLFQEALNFLPIMTSWSLKNTDKENRLAEVTGLASNAAAAALNAGEAASFAL
GLLELGRGVISGLLLDMRGDVSEVEQRYPALAQEFKSLRDELDSFGEDKLPQTISNSIESWESRAKRRQKADQRL
SEIITRIRAQPGFHGFLLPPSPEELMAAANPNPIVVVNGSQFRYDAFLIKHDEIKVLPLPDLNKKELEERILQLR
SCRLSSSSDMASVLEWLWNAAAGPILDALGFKDAISDEENWPRMWWIPTGLLSQLPFHAAGFHVKGSGETVLDRV
MSSYAISVKALIRGRRLHSQASTGPLSNHALLVAMGETPNLGVNAVLPFAVEEAEVVRSLCPSLDLQPIIPACHK
DQVLKLVQTCKIFHFAGHGQMNSKEPSKSLLLLKDWKTNPLTVGDLRDHKIEKNPPFLGFLSACSTGANETTKLS
DEGIHLINAFQLAGFRHVVGTLWEVSDKLCVDVSRRLYETMRDQGMTDDAVCRGLHRATRELRDRTTTKSRRTRD
AKLVSLQTTAQGFMASHWVPYVHFGV*
Coding >OphauB2|4184
ATGAGAGCTTTGCTCCACGACATGGACGATGAAGAGTTACGCTCCTTTGCGGAAATGCATCAAGGCATCGCAAAT
GATGATCAGACCGAGCTGTATATCTTTACTTGTCTCCTTCTCTTCACGAGAACAGATTCAACGGATTATCTTGAG
CAAGCCATTCAGCGAATGAAAGAAATGACTGCGCCTATTGGCCGTCCCGATCGCGCAAGGCTGCTTCATATTCTC
AACGCGATGTCGGTGCAATTGAGGCTATTTAGACTTGGTCTAAAGAGCACTATAGCCAGTCAACAAACTGGCCTA
CACCTCCAAGTCAATCCTCGAAATAATCCGGCAGACAAAAATGGTTATATAGCCAAGCTCACTGAGAGCATAGAA
AGAACGGATCGGGAAATAAACACGGCTCAAGAAGACGACCAGGCGAGCTTATTGAACAACCTCGCAGCTCTCTTA
TTCAGCCGATTCGAGCTGACAGATTCGACAAACGACCTTAATCGTGCCATCAATGTTGCGACCATGGCAGTGAAT
ACCACGTTTGACGACATGCACTATCTAGTTTCCAGGCGATTTAATCTTATAAGAATTCTTATGCGGCGATTTGAG
CGCACAAATTCGATACACGACCTAAATCGTATTATTCGAATTGCGGATGTGGTAATAAATACCACAGCTGCAGGC
GATGGGTATCTACCTCCCACGCGTCATGTGCTCATAACCCATCTCATCCAACGGTTCAATCGCACAGATTCGATA
GACGACTGTCATCGTATCATTGAAGTTATTGCTCTGTCAGTTGACGCTGATCCTCAAGACTACCCTGTTCGAGCC
AGTCTTGTCCATTGGCTCGGCATCCGGTTCGAGCGTACAGGTTCAAAAGATGACCTTAATCGTGCATTTCAGATT
ATTGAGGCAACGGTAGAAGATGCATCAAAAGATCATGGAAGAGCCGACATGTGGAGCAATATCGCACCCAGGCTT
GAAGCTCGCTATGAGCGAACCAATTCCGTAGATGAACTCAATCATCTTAGCGACACCTTAACCAAGGCTGTAGAG
GCCAACATTAGAAGAAATGTCCATCGACTTAGGCCCCTCAACGCGCTTATGTTGTGCCTCTACAAAAAGGCTGAA
AGAACGGGGGTAGTGGACAAACTGGACTTTGCAATCGAAGCTGCGATGACCGCCGTGGAGGCTACAGAGCAAGGG
ATTCCATACCGAAATGACACGCTACATGTTCTTGCCATCTCTCTCCGTCTGCGATTTGACAGAACCAACTCGACA
GACGATTTAAATCTTGCTATTGACTATGCTATTATGGCTGTTGGGGCGTCTAAAGATGATTACCAACATCCGAAT
CTGCGACAACTCGCATTGAGTAACCTGACGATTTGTCTCTGGAAAAGATTTGATAGAATCGGCACCATAGATGAC
CTTGATCATGCCATCGATGTTGCGAGTCAAGCCGTCGACTCTGCTTCTCAGGACAATAGTTCTCGGGCTACATGC
CTGGAAAGCTTGGCCTTTTGTCTTGACAGCCGATTCATGCTAATTCGTTCGATTCAGGATATTAACAGCGCCATC
GATCATTTCAAAATGGCAATAGAAATGACTCCTCCAGATTCCTTTGACCGGTTTAGAATTCTCAACGCCCTAGCA
TTGTGTCTCAACAGTCGATTTGAATATAACGGCTCCATGGAAGATTTTAATGAAGCCGTTACACACTTGACTACG
GTTGTCAATACTCACCCTTCAAGCGACGCCAATCACGCTATTTACTTGGCAAACCTGGGAGTATTGCATGGCAAA
CATTTTGATGAAACAGACTCAATGACCGACATTAATCGTGCCGTTGAGCTCATCACCTTGGCCCTGGATACTACA
CCTCAGCAAGTCCCCGAACGTGCTACTCGACTTAACAATCTCGGAATCTTTTTGCACAAGAGGTCCATGCGAACC
GACTCAATAGACGACGCTGACCGTGCCTTGTCATTACACCAAGAAGGCTGGCGTTGTCATTCTGGCCTCCCAAAC
ATTCGTATGCATTCAGCAAAGAATGGCGCCATGATTCTCGCGTCACAATCTCGATGGCCAGAATCAAATAAGCTC
TTTCAGGAGGCCTTGAATTTCTTGCCCATTATGACCTCGTGGTCTTTGAAGAATACAGACAAGGAAAACCGGCTT
GCAGAAGTGACAGGCTTGGCTTCGAATGCGGCTGCGGCTGCTCTCAATGCCGGAGAGGCCGCTTCTTTTGCTTTG
GGACTTCTCGAACTTGGCCGCGGTGTCATTAGTGGCTTGCTACTAGACATGCGCGGAGATGTCTCTGAAGTAGAG
CAACGCTACCCTGCCTTGGCGCAAGAGTTTAAATCGCTTCGCGACGAGCTGGATTCGTTCGGAGAGGATAAGCTA
CCACAAACAATTAGCAATAGTATTGAATCGTGGGAATCAAGAGCCAAACGGCGTCAGAAGGCTGACCAGAGACTG
AGCGAGATTATTACCAGGATTCGCGCTCAACCCGGATTTCATGGCTTTCTGCTTCCTCCTTCCCCAGAGGAGTTG
ATGGCGGCGGCAAACCCAAACCCCATTGTTGTTGTCAATGGGAGCCAGTTTCGCTACGATGCATTTCTAATAAAA
CACGATGAAATCAAAGTCTTGCCCTTACCCGACCTCAATAAAAAGGAATTGGAGGAACGAATCCTTCAACTACGA
TCATGTCGCTTATCAAGCTCCTCCGACATGGCATCTGTACTAGAATGGCTCTGGAATGCGGCCGCTGGCCCAATA
CTGGATGCCCTCGGGTTTAAGGACGCTATATCTGATGAAGAAAATTGGCCTCGGATGTGGTGGATTCCCACTGGT
CTTCTCAGCCAACTACCCTTCCACGCAGCCGGTTTCCATGTCAAGGGCAGCGGTGAGACTGTGCTCGATAGAGTC
ATGTCATCATACGCGATATCCGTCAAGGCATTGATACGTGGGCGTCGACTCCACAGCCAAGCATCTACTGGGCCG
CTTTCTAACCACGCTCTGCTCGTCGCCATGGGCGAAACGCCAAATCTTGGAGTCAACGCAGTCCTTCCATTTGCG
GTAGAGGAAGCAGAAGTAGTACGAAGTCTCTGTCCGTCTCTTGACTTGCAACCAATCATTCCGGCATGTCATAAA
GACCAAGTACTTAAACTTGTGCAAACGTGCAAAATATTCCATTTTGCCGGCCATGGACAGATGAACTCAAAGGAG
CCTTCGAAGAGTCTTTTGCTCCTCAAAGACTGGAAAACTAATCCACTTACCGTGGGAGATCTCCGCGATCACAAA
ATAGAGAAAAATCCACCCTTTCTTGGATTTCTCTCGGCTTGTTCGACTGGGGCCAACGAGACAACCAAACTTTCC
GACGAAGGAATACATCTGATCAATGCCTTTCAGCTCGCGGGCTTCCGGCACGTTGTGGGCACACTCTGGGAAGTG
TCGGACAAGCTTTGCGTTGATGTGTCGAGAAGGCTCTACGAGACGATGCGAGATCAAGGCATGACGGACGATGCA
GTCTGTCGAGGGCTTCATCGAGCAACTCGAGAGCTACGAGACAGGACTACCACAAAATCGAGGAGGACGAGAGAT
GCCAAGTTGGTATCTTTGCAAACAACAGCACAAGGCTTCATGGCTTCACACTGGGTTCCCTATGTTCACTTTGGT
GTTTAA
Transcript >OphauB2|4184
ATGAGAGCTTTGCTCCACGACATGGACGATGAAGAGTTACGCTCCTTTGCGGAAATGCATCAAGGCATCGCAAAT
GATGATCAGACCGAGCTGTATATCTTTACTTGTCTCCTTCTCTTCACGAGAACAGATTCAACGGATTATCTTGAG
CAAGCCATTCAGCGAATGAAAGAAATGACTGCGCCTATTGGCCGTCCCGATCGCGCAAGGCTGCTTCATATTCTC
AACGCGATGTCGGTGCAATTGAGGCTATTTAGACTTGGTCTAAAGAGCACTATAGCCAGTCAACAAACTGGCCTA
CACCTCCAAGTCAATCCTCGAAATAATCCGGCAGACAAAAATGGTTATATAGCCAAGCTCACTGAGAGCATAGAA
AGAACGGATCGGGAAATAAACACGGCTCAAGAAGACGACCAGGCGAGCTTATTGAACAACCTCGCAGCTCTCTTA
TTCAGCCGATTCGAGCTGACAGATTCGACAAACGACCTTAATCGTGCCATCAATGTTGCGACCATGGCAGTGAAT
ACCACGTTTGACGACATGCACTATCTAGTTTCCAGGCGATTTAATCTTATAAGAATTCTTATGCGGCGATTTGAG
CGCACAAATTCGATACACGACCTAAATCGTATTATTCGAATTGCGGATGTGGTAATAAATACCACAGCTGCAGGC
GATGGGTATCTACCTCCCACGCGTCATGTGCTCATAACCCATCTCATCCAACGGTTCAATCGCACAGATTCGATA
GACGACTGTCATCGTATCATTGAAGTTATTGCTCTGTCAGTTGACGCTGATCCTCAAGACTACCCTGTTCGAGCC
AGTCTTGTCCATTGGCTCGGCATCCGGTTCGAGCGTACAGGTTCAAAAGATGACCTTAATCGTGCATTTCAGATT
ATTGAGGCAACGGTAGAAGATGCATCAAAAGATCATGGAAGAGCCGACATGTGGAGCAATATCGCACCCAGGCTT
GAAGCTCGCTATGAGCGAACCAATTCCGTAGATGAACTCAATCATCTTAGCGACACCTTAACCAAGGCTGTAGAG
GCCAACATTAGAAGAAATGTCCATCGACTTAGGCCCCTCAACGCGCTTATGTTGTGCCTCTACAAAAAGGCTGAA
AGAACGGGGGTAGTGGACAAACTGGACTTTGCAATCGAAGCTGCGATGACCGCCGTGGAGGCTACAGAGCAAGGG
ATTCCATACCGAAATGACACGCTACATGTTCTTGCCATCTCTCTCCGTCTGCGATTTGACAGAACCAACTCGACA
GACGATTTAAATCTTGCTATTGACTATGCTATTATGGCTGTTGGGGCGTCTAAAGATGATTACCAACATCCGAAT
CTGCGACAACTCGCATTGAGTAACCTGACGATTTGTCTCTGGAAAAGATTTGATAGAATCGGCACCATAGATGAC
CTTGATCATGCCATCGATGTTGCGAGTCAAGCCGTCGACTCTGCTTCTCAGGACAATAGTTCTCGGGCTACATGC
CTGGAAAGCTTGGCCTTTTGTCTTGACAGCCGATTCATGCTAATTCGTTCGATTCAGGATATTAACAGCGCCATC
GATCATTTCAAAATGGCAATAGAAATGACTCCTCCAGATTCCTTTGACCGGTTTAGAATTCTCAACGCCCTAGCA
TTGTGTCTCAACAGTCGATTTGAATATAACGGCTCCATGGAAGATTTTAATGAAGCCGTTACACACTTGACTACG
GTTGTCAATACTCACCCTTCAAGCGACGCCAATCACGCTATTTACTTGGCAAACCTGGGAGTATTGCATGGCAAA
CATTTTGATGAAACAGACTCAATGACCGACATTAATCGTGCCGTTGAGCTCATCACCTTGGCCCTGGATACTACA
CCTCAGCAAGTCCCCGAACGTGCTACTCGACTTAACAATCTCGGAATCTTTTTGCACAAGAGGTCCATGCGAACC
GACTCAATAGACGACGCTGACCGTGCCTTGTCATTACACCAAGAAGGCTGGCGTTGTCATTCTGGCCTCCCAAAC
ATTCGTATGCATTCAGCAAAGAATGGCGCCATGATTCTCGCGTCACAATCTCGATGGCCAGAATCAAATAAGCTC
TTTCAGGAGGCCTTGAATTTCTTGCCCATTATGACCTCGTGGTCTTTGAAGAATACAGACAAGGAAAACCGGCTT
GCAGAAGTGACAGGCTTGGCTTCGAATGCGGCTGCGGCTGCTCTCAATGCCGGAGAGGCCGCTTCTTTTGCTTTG
GGACTTCTCGAACTTGGCCGCGGTGTCATTAGTGGCTTGCTACTAGACATGCGCGGAGATGTCTCTGAAGTAGAG
CAACGCTACCCTGCCTTGGCGCAAGAGTTTAAATCGCTTCGCGACGAGCTGGATTCGTTCGGAGAGGATAAGCTA
CCACAAACAATTAGCAATAGTATTGAATCGTGGGAATCAAGAGCCAAACGGCGTCAGAAGGCTGACCAGAGACTG
AGCGAGATTATTACCAGGATTCGCGCTCAACCCGGATTTCATGGCTTTCTGCTTCCTCCTTCCCCAGAGGAGTTG
ATGGCGGCGGCAAACCCAAACCCCATTGTTGTTGTCAATGGGAGCCAGTTTCGCTACGATGCATTTCTAATAAAA
CACGATGAAATCAAAGTCTTGCCCTTACCCGACCTCAATAAAAAGGAATTGGAGGAACGAATCCTTCAACTACGA
TCATGTCGCTTATCAAGCTCCTCCGACATGGCATCTGTACTAGAATGGCTCTGGAATGCGGCCGCTGGCCCAATA
CTGGATGCCCTCGGGTTTAAGGACGCTATATCTGATGAAGAAAATTGGCCTCGGATGTGGTGGATTCCCACTGGT
CTTCTCAGCCAACTACCCTTCCACGCAGCCGGTTTCCATGTCAAGGGCAGCGGTGAGACTGTGCTCGATAGAGTC
ATGTCATCATACGCGATATCCGTCAAGGCATTGATACGTGGGCGTCGACTCCACAGCCAAGCATCTACTGGGCCG
CTTTCTAACCACGCTCTGCTCGTCGCCATGGGCGAAACGCCAAATCTTGGAGTCAACGCAGTCCTTCCATTTGCG
GTAGAGGAAGCAGAAGTAGTACGAAGTCTCTGTCCGTCTCTTGACTTGCAACCAATCATTCCGGCATGTCATAAA
GACCAAGTACTTAAACTTGTGCAAACGTGCAAAATATTCCATTTTGCCGGCCATGGACAGATGAACTCAAAGGAG
CCTTCGAAGAGTCTTTTGCTCCTCAAAGACTGGAAAACTAATCCACTTACCGTGGGAGATCTCCGCGATCACAAA
ATAGAGAAAAATCCACCCTTTCTTGGATTTCTCTCGGCTTGTTCGACTGGGGCCAACGAGACAACCAAACTTTCC
GACGAAGGAATACATCTGATCAATGCCTTTCAGCTCGCGGGCTTCCGGCACGTTGTGGGCACACTCTGGGAAGTG
TCGGACAAGCTTTGCGTTGATGTGTCGAGAAGGCTCTACGAGACGATGCGAGATCAAGGCATGACGGACGATGCA
GTCTGTCGAGGGCTTCATCGAGCAACTCGAGAGCTACGAGACAGGACTACCACAAAATCGAGGAGGACGAGAGAT
GCCAAGTTGGTATCTTTGCAAACAACAGCACAAGGCTTCATGGCTTCACACTGGGTTCCCTATGTTCACTTTGGT
GTTTAA
Gene >OphauB2|4184
ATGAGAGCTTTGCTCCACGACATGGACGATGAAGAGTTACGCTCCTTTGCGGAAATGCATCAAGGCATCGCAAAT
GATGATCAGACCGAGCTGTATATCTTTACTTGTCTCCTTCTCTTCACGAGAACAGATTCAACGGATTATCTTGAG
CAAGCCATTCAGCGAATGAAAGAAATGACTGCGCCTATTGGCCGTCCCGATCGCGCAAGGCTGCTTCATATTCTC
AACGCGATGTCGGTGCAATTGAGGCTATTTAGACTTGGTCTAAAGAGCACTATAGCCAGGTAACTAGTACTCTTG
TTCCAACTGCCCCAAGCAATTACATTACCTGGTGTGGTAAGATTTTGCTAACACGCTGGCATCTCAGTCAACAAA
CTGGCCTACACCTCCAAGTCAATCCTCGAAATAATCCGGCAGACAAAAATGGTTATATAGCCAAGCTCACTGAGA
GCATAGAAAGAACGGATCGGGAAATAAACACGGCTCAAGAAGACGACCAGGCGAGCTTATTGAACAACCTCGCAG
CTCTCTTATTCAGCCGATTCGAGCTGACAGATTCGACAAACGACCTTAATCGTGCCATCAATGTTGCGACCATGG
CAGTGAATACCACGTTTGACGACATGCACTATCTAGTTTCCAGGCGATTTAATCTTATAAGAATTCTTATGCGGC
GATTTGAGCGCACAAATTCGATACACGACCTAAATCGTATTATTCGAATTGCGGATGTGGTAATAAATACCACAG
CTGCAGGCGATGGGTATCTACCTCCCACGCGTCATGTGCTCATAACCCATCTCATCCAACGGTTCAATCGCACAG
ATTCGATAGACGACTGTCATCGTATCATTGAAGTTATTGCTCTGTCAGTTGACGCTGATCCTCAAGACTACCCTG
TTCGAGCCAGTCTTGTCCATTGGCTCGGCATCCGGTTCGAGCGTACAGGTTCAAAAGATGACCTTAATCGTGCAT
TTCAGATTATTGAGGCAACGGTAGAAGATGCATCAAAAGATCATGGAAGAGCCGACATGTGGAGCAATATCGCAC
CCAGGCTTGAAGCTCGCTATGAGCGAACCAATTCCGTAGATGAACTCAATCATCTTAGCGACACCTTAACCAAGG
CTGTAGAGGCCAACATTAGAAGAAATGTCCATCGACTTAGGCCCCTCAACGCGCTTATGTTGTGCCTCTACAAAA
AGGCTGAAAGAACGGGGGTAGTGGACAAACTGGACTTTGCAATCGAAGCTGCGATGACCGCCGTGGAGGCTACAG
AGCAAGGGATTCCATACCGAAATGACACGCTACATGTTCTTGCCATCTCTCTCCGTCTGCGATTTGACAGAACCA
ACTCGACAGACGATTTAAATCTTGCTATTGACTATGCTATTATGGCTGTTGGGGCGTCTAAAGATGATTACCAAC
ATCCGAATCTGCGACAACTCGCATTGAGTAACCTGACGATTTGTCTCTGGAAAAGATTTGATAGAATCGGCACCA
TAGATGACCTTGATCATGCCATCGATGTTGCGAGTCAAGCCGTCGACTCTGCTTCTCAGGACAATAGTTCTCGGG
CTACATGCCTGGAAAGCTTGGCCTTTTGTCTTGACAGCCGATTCATGCTAATTCGTTCGATTCAGGATATTAACA
GCGCCATCGATCATTTCAAAATGGCAATAGAAATGACTCCTCCAGATTCCTTTGACCGGTTTAGAATTCTCAACG
CCCTAGCATTGTGTCTCAACAGTCGATTTGAATATAACGGCTCCATGGAAGATTTTAATGAAGCCGTTACACACT
TGACTACGGTTGTCAATACTCACCCTTCAAGCGACGCCAATCACGCTATTTACTTGGCAAACCTGGGAGTATTGC
ATGGCAAACATTTTGATGAAACAGACTCAATGACCGACATTAATCGTGCCGTTGAGCTCATCACCTTGGCCCTGG
ATACTACACCTCAGCAAGTCCCCGAACGTGCTACTCGACTTAACAATCTCGGAATCTTTTTGCACAAGAGGTCCA
TGCGAACCGACTCAATAGACGACGCTGACCGTGCCTTGTCATTACACCAAGAAGGCTGGCGTTGTCATTCTGGCC
TCCCAAACATTCGTATGCATTCAGCAAAGAATGGCGCCATGATTCTCGCGTCACAATCTCGATGGCCAGAATCAA
ATAAGCTCTTTCAGGAGGCCTTGAATTTCTTGCCCATTATGACCTCGTGGTCTTTGAAGAATACAGACAAGGAAA
ACCGGCTTGCAGAAGTGACAGGCTTGGCTTCGAATGCGGCTGCGGCTGCTCTCAATGCCGGAGAGGCCGCTTCTT
TTGCTTTGGGACTTCTCGAACTTGGCCGCGGTGTCATTAGTGGCTTGCTACTAGACATGCGCGGAGATGTCTCTG
AAGTAGAGCAACGCTACCCTGCCTTGGCGCAAGAGTTTAAATCGCTTCGCGACGAGCTGGATTCGTTCGGAGAGG
ATAAGCTACCACAAACAATTAGCAATAGTATTGAATCGTGGGAATCAAGAGCCAAACGGCGTCAGAAGGCTGACC
AGAGACTGAGCGAGATTATTACCAGGATTCGCGCTCAACCCGGATTTCATGGCTTTCTGCTTCCTCCTTCCCCAG
AGGAGTTGATGGCGGCGGCAAACCCAAACCCCATTGTTGTTGTCAATGGGAGCCAGTTTCGCTACGATGCATTTC
TAATAAAACACGATGAAATCAAAGTCTTGCCCTTACCCGACCTCAATAAAAAGGAATTGGAGGAACGAATCCTTC
AACTACGATCATGTCGCTTATCAAGCTCCTCCGACATGGCATCTGTACTAGAATGGCTCTGGAATGCGGCCGCTG
GCCCAATACTGGATGCCCTCGGGTTTAAGGACGCTATATCTGATGAAGAAAATTGGCCTCGGATGTGGTGGATTC
CCACTGGTCTTCTCAGCCAACTACCCTTCCACGCAGCCGGTTTCCATGTCAAGGGCAGCGGTGAGACTGTGCTCG
ATAGAGTCATGTCATCATACGCGATATCCGTCAAGGCATTGATACGTGGGCGTCGACTCCACAGCCAAGCATCTA
CTGGGCCGCTTTCTAACCACGCTCTGCTCGTCGCCATGGGCGAAACGCCAAATCTTGGAGTCAACGCAGTCCTTC
CATTTGCGGTAGAGGAAGCAGAAGTAGTACGAAGTCTCTGTCCGTCTCTTGACTTGCAACCAATCATTCCGGCAT
GTCATAAAGACCAAGTACTTAAACTTGTGCAAACGTGCAAAATATTCCATTTTGCCGGCCATGGACAGATGAACT
CAAAGGAGCCTTCGAAGAGTCTTTTGCTCCTCAAAGACTGGAAAACTAATCCACTTACCGTGGGAGATCTCCGCG
ATCACAAAATAGAGAAAAATCCACCCTTTCTTGGATTTCTCTCGGCTTGTTCGACTGGGGCCAACGAGACAACCA
AACTTTCCGACGAAGGAATACATCTGATCAATGCCTTTCAGCTCGCGGGCTTCCGGCACGTTGTGGGCACACTCT
GGGAAGTGTCGGACAAGCTTTGCGTTGATGTGTCGAGAAGGCTCTACGAGACGATGCGAGATCAAGGCATGACGG
ACGATGCAGTCTGTCGAGGGCTTCATCGAGCAACTCGAGAGCTACGAGACAGGACTACCACAAAATCGAGGAGGA
CGAGAGATGCCAAGTTGGTATCTTTGCAAACAACAGCACAAGGCTTCATGGCTTCACACTGGGTTCCCTATGTTC
ACTTTGGTGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail