Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4181
Gene name
LocationContig_277:3823..8860
Strand+
Gene length (bp)5037
Transcript length (bp)5037
Coding sequence length (bp)5037
Protein length (aa) 1679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.6E-67 270 666
PF01212 Beta_elim_lyase Beta-eliminating lyase 5.0E-61 1334 1618
PF07993 NAD_binding_4 Male sterility protein 4.7E-39 943 1161
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.4E-08 941 1180
PF00550 PP-binding Phosphopantetheine attachment site 3.6E-06 841 889
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 6.9E-06 943 1211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 243 782 1.0E-129
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 76 772 3.0E-129
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 79 863 2.0E-127
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 65 768 7.0E-121
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 71 802 8.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 243 782 1.0E-129
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 76 772 3.0E-129
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 79 863 2.0E-127
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 65 768 7.0E-121
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 71 802 8.0E-109
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 71 802 3.0E-108
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 213 770 5.0E-107
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 39 765 4.0E-106
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 79 770 8.0E-106
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 68 771 1.0E-105
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 47 802 3.0E-105
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 68 769 2.0E-103
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 213 798 1.0E-102
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 262 769 1.0E-100
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 262 769 1.0E-100
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 262 769 2.0E-99
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 27 768 4.0E-98
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 53 798 4.0E-95
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 7 772 3.0E-93
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 200 1251 2.0E-92
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 69 789 3.0E-92
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 259 822 2.0E-91
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 236 864 6.0E-87
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 73 888 2.0E-85
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 52 809 4.0E-85
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 70 768 2.0E-81
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 217 775 4.0E-81
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 233 775 8.0E-79
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 66 771 7.0E-78
sp|O74267|GLY1_ASHGO Low-specificity L-threonine aldolase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLY1 PE=3 SV=3 1331 1663 2.0E-76
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 70 768 2.0E-75
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 70 768 4.0E-75
sp|P37303|GLY1_YEAST Low specificity L-threonine aldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLY1 PE=1 SV=2 1331 1663 3.0E-73
sp|Q9UW18|TOXG_COCCA Alanine racemase TOXG OS=Cochliobolus carbonum GN=TOXG PE=3 SV=1 1320 1675 6.0E-73
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 186 1249 1.0E-70
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 260 804 4.0E-70
sp|O13427|GLY1_CANAX Low-specificity L-threonine aldolase OS=Candida albicans GN=GLY1 PE=3 SV=1 1333 1659 4.0E-70
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 65 927 4.0E-70
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 70 788 3.0E-68
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 74 903 3.0E-68
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 290 1286 7.0E-68
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 70 874 2.0E-67
sp|O13940|GLY1_SCHPO Probable low-specificity L-threonine aldolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gly1 PE=3 SV=1 1310 1674 3.0E-67
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 75 768 2.0E-66
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 30 768 1.0E-65
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 75 819 1.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 70 770 5.0E-65
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 264 1286 8.0E-65
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 75 880 2.0E-64
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 78 768 4.0E-64
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 59 774 7.0E-64
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 230 1286 8.0E-64
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 75 962 3.0E-63
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 70 770 6.0E-63
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 50 768 5.0E-62
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 70 889 7.0E-62
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 70 907 7.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 242 815 8.0E-62
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 70 889 2.0E-61
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 75 770 3.0E-61
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 69 770 1.0E-60
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 70 889 2.0E-60
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 203 1229 2.0E-60
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 55 768 3.0E-60
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 75 774 3.0E-60
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 75 826 9.0E-60
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 75 770 2.0E-59
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 73 778 2.0E-59
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 75 768 6.0E-59
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 70 768 1.0E-58
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 252 768 2.0E-58
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 75 864 2.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 224 768 4.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 224 768 6.0E-58
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 75 775 6.0E-58
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 173 768 7.0E-58
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 257 834 1.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 44 770 2.0E-57
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 70 900 3.0E-57
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 78 770 1.0E-56
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 78 768 2.0E-56
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 88 768 3.0E-56
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 73 768 4.0E-56
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 44 770 1.0E-55
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 254 770 2.0E-55
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 49 775 2.0E-55
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 70 768 5.0E-55
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 254 770 8.0E-55
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 70 768 8.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 183 778 1.0E-54
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 75 775 1.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 58 889 3.0E-54
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 215 768 3.0E-54
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 224 768 8.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 75 889 1.0E-53
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 78 768 1.0E-53
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 70 768 1.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 263 764 2.0E-53
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 58 815 4.0E-53
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 232 768 4.0E-53
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 54 908 1.0E-52
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 213 817 2.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 69 873 2.0E-52
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 70 770 2.0E-52
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 239 764 4.0E-52
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 70 893 6.0E-52
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 260 771 8.0E-52
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 289 1286 8.0E-52
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 78 768 1.0E-51
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 65 776 9.0E-51
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 78 768 2.0E-50
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 52 802 2.0E-50
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 75 886 3.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 36 768 4.0E-50
sp|O07051|LTAA_AERJA L-allo-threonine aldolase OS=Aeromonas jandaei GN=ltaA PE=1 SV=1 1334 1667 1.0E-49
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 232 936 2.0E-49
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 213 680 2.0E-49
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 226 1115 2.0E-49
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 153 771 3.0E-49
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 199 768 7.0E-49
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 69 768 1.0E-48
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 75 768 2.0E-48
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 75 768 3.0E-48
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 70 769 5.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 236 880 1.0E-47
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 236 880 1.0E-47
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 69 770 3.0E-47
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 267 768 4.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 250 778 1.0E-46
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 236 764 2.0E-45
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 236 764 3.0E-45
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 267 770 4.0E-45
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 45 768 6.0E-45
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 267 777 7.0E-45
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 47 768 3.0E-44
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 218 768 6.0E-44
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 213 768 7.0E-44
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 179 764 3.0E-43
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 218 768 3.0E-43
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 251 1116 1.0E-42
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 218 768 4.0E-42
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 269 772 9.0E-42
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 277 768 1.0E-41
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 277 768 1.0E-41
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 277 768 1.0E-41
sp|Q8RXU4|THA1_ARATH Probable low-specificity L-threonine aldolase 1 OS=Arabidopsis thaliana GN=THA1 PE=1 SV=1 1332 1677 1.0E-41
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 277 768 2.0E-41
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 277 768 2.0E-41
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 277 768 2.0E-41
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 277 768 2.0E-41
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 277 768 3.0E-41
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 277 768 3.0E-41
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 290 771 3.0E-41
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 267 768 1.0E-40
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 277 768 1.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 277 768 1.0E-40
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 277 768 1.0E-40
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 269 777 1.0E-40
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 277 768 1.0E-40
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 277 768 2.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 216 891 2.0E-40
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 238 764 2.0E-40
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 277 768 4.0E-40
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 264 764 5.0E-40
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 249 773 6.0E-40
sp|P75823|LTAE_ECOLI Low specificity L-threonine aldolase OS=Escherichia coli (strain K12) GN=ltaE PE=1 SV=1 1334 1673 9.0E-40
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 65 770 2.0E-39
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 265 777 2.0E-39
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 254 797 3.0E-39
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 280 768 5.0E-39
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 197 764 7.0E-39
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 280 768 1.0E-38
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 280 768 2.0E-38
sp|P58319|LTAE_ECO57 Low specificity L-threonine aldolase OS=Escherichia coli O157:H7 GN=ltaE PE=3 SV=1 1334 1673 2.0E-38
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 74 772 2.0E-38
sp|Q9FPH3|THA2_ARATH Probable low-specificity L-threonine aldolase 2 OS=Arabidopsis thaliana GN=THA2 PE=1 SV=1 1334 1671 1.0E-37
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 254 787 2.0E-37
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 254 787 2.0E-37
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 254 787 2.0E-37
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 216 681 2.0E-37
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 267 764 2.0E-37
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 267 772 2.0E-37
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 274 768 2.0E-37
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 267 772 3.0E-37
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 267 772 3.0E-37
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 267 772 3.0E-37
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 269 772 4.0E-37
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 264 765 7.0E-37
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 267 764 9.0E-37
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 267 764 9.0E-37
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 267 764 9.0E-37
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 267 764 9.0E-37
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 274 768 3.0E-36
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 274 768 4.0E-36
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 274 768 5.0E-36
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 269 771 6.0E-36
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 274 769 7.0E-36
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 267 771 9.0E-36
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 267 764 9.0E-36
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 267 764 9.0E-36
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 274 770 1.0E-35
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 271 864 1.0E-35
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 269 771 2.0E-35
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 267 771 2.0E-35
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 269 771 2.0E-35
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 264 764 3.0E-35
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 264 764 4.0E-35
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 264 764 4.0E-35
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 281 890 4.0E-35
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 281 890 4.0E-35
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 267 770 2.0E-34
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 262 768 2.0E-34
sp|Q21890|YF64_CAEEL Uncharacterized protein R102.4 OS=Caenorhabditis elegans GN=R102.4 PE=3 SV=3 1326 1567 2.0E-34
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 262 768 2.0E-34
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 277 772 3.0E-34
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 269 764 6.0E-34
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 289 807 1.0E-33
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 264 822 4.0E-33
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 260 676 2.0E-32
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 289 769 1.0E-30
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 326 770 3.0E-29
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 284 773 5.0E-28
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 267 770 6.0E-28
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 842 1263 8.0E-28
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 837 1227 6.0E-26
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 259 699 8.0E-26
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 257 764 2.0E-24
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 842 1180 3.0E-20
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 548 758 4.0E-20
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 404 1166 7.0E-20
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 332 676 2.0E-19
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 267 770 3.0E-19
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 402 1218 1.0E-18
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 331 782 2.0E-17
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 936 1168 2.0E-17
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 269 771 5.0E-17
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 315 768 2.0E-16
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 408 771 1.0E-15
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 40 285 1.0E-15
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 289 771 2.0E-15
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 289 785 3.0E-15
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 269 770 1.0E-14
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 282 776 2.0E-14
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 907 1173 2.0E-14
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 269 770 2.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 408 771 2.0E-14
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 409 776 3.0E-14
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 409 770 3.0E-14
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 399 785 6.0E-14
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 403 783 8.0E-14
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 403 773 2.0E-13
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 399 785 4.0E-13
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 399 785 5.0E-13
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 399 785 8.0E-13
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 399 785 8.0E-13
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 399 785 1.0E-12
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 399 785 2.0E-12
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 399 785 2.0E-12
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 404 774 2.0E-12
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 399 785 2.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 277 768 2.0E-12
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 289 771 2.0E-12
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 384 771 4.0E-12
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 907 1202 5.0E-12
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 268 771 9.0E-12
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 409 768 1.0E-11
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 917 1193 1.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 409 773 1.0E-11
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 404 770 2.0E-11
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 388 784 2.0E-11
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 398 769 3.0E-11
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 277 775 3.0E-11
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 387 770 4.0E-11
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 289 769 6.0E-11
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 284 769 7.0E-11
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 941 1159 7.0E-11
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 404 773 8.0E-11
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 404 773 8.0E-11
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 384 769 1.0E-10
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 393 773 1.0E-10
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 918 1163 1.0E-10
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 409 773 2.0E-10
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 409 773 2.0E-10
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 392 769 2.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 404 776 2.0E-10
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 290 769 2.0E-10
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 288 769 2.0E-10
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 288 769 2.0E-10
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 409 773 2.0E-10
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 409 773 2.0E-10
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 409 773 2.0E-10
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 409 773 2.0E-10
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 290 769 3.0E-10
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 364 770 3.0E-10
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 290 769 3.0E-10
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 288 769 3.0E-10
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 290 769 3.0E-10
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 288 769 3.0E-10
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 388 784 4.0E-10
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 290 769 4.0E-10
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 288 769 4.0E-10
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 288 769 5.0E-10
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 277 775 5.0E-10
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 288 769 5.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 268 776 5.0E-10
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 277 775 6.0E-10
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 400 769 6.0E-10
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 400 769 6.0E-10
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 277 775 7.0E-10
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 289 776 7.0E-10
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 849 1173 7.0E-10
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 290 769 7.0E-10
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 409 779 7.0E-10
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 288 769 7.0E-10
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 288 769 7.0E-10
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 288 769 8.0E-10
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 382 782 9.0E-10
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 382 782 9.0E-10
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 290 769 9.0E-10
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 290 769 1.0E-09
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 334 769 1.0E-09
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 290 769 1.0E-09
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 290 769 1.0E-09
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 390 770 1.0E-09
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 382 677 1.0E-09
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 281 769 1.0E-09
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 277 771 1.0E-09
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 407 762 1.0E-09
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 280 770 1.0E-09
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 280 770 1.0E-09
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 280 770 1.0E-09
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 290 769 1.0E-09
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 290 769 1.0E-09
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 288 769 1.0E-09
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 404 770 1.0E-09
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 409 744 1.0E-09
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 277 775 2.0E-09
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 267 782 2.0E-09
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 289 769 2.0E-09
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 290 769 2.0E-09
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 277 775 2.0E-09
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 290 769 2.0E-09
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 290 769 2.0E-09
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 382 677 2.0E-09
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 382 677 2.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 382 769 2.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 378 769 2.0E-09
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 382 677 2.0E-09
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 382 677 2.0E-09
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 382 677 2.0E-09
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 382 677 3.0E-09
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 382 769 3.0E-09
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 382 677 3.0E-09
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 274 770 3.0E-09
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 382 677 3.0E-09
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 382 677 3.0E-09
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 334 770 3.0E-09
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 928 1173 3.0E-09
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 290 769 4.0E-09
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 327 770 5.0E-09
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 364 769 5.0E-09
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 411 770 5.0E-09
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 286 770 6.0E-09
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 286 770 6.0E-09
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 382 677 6.0E-09
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 382 677 6.0E-09
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 290 769 6.0E-09
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 290 769 6.0E-09
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 290 769 7.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 378 769 7.0E-09
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 403 770 8.0E-09
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 288 769 8.0E-09
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 255 765 9.0E-09
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 268 771 1.0E-08
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 290 769 1.0E-08
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 290 769 1.0E-08
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 290 769 1.0E-08
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 290 769 1.0E-08
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 290 769 1.0E-08
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 290 712 1.0E-08
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 404 776 2.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 408 770 2.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 403 770 2.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 403 770 2.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 409 772 3.0E-08
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 389 769 3.0E-08
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 407 771 4.0E-08
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 379 769 4.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 263 774 5.0E-08
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 289 769 6.0E-08
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 255 772 7.0E-08
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 404 771 7.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 402 769 9.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 364 770 9.0E-08
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 290 769 9.0E-08
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 403 770 1.0E-07
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 384 769 2.0E-07
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 305 776 2.0E-07
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 408 770 3.0E-07
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 408 770 3.0E-07
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 289 769 3.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 334 770 3.0E-07
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 325 769 4.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 403 687 4.0E-07
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 265 680 9.0E-07
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 592 775 9.0E-07
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 404 768 9.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 404 768 1.0E-06
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 265 433 1.0E-06
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 265 433 1.0E-06
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 265 433 1.0E-06
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 261 765 4.0E-06
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 261 765 4.0E-06
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 261 765 4.0E-06
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 358 770 5.0E-06
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 402 769 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0003824 catalytic activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0050662 coenzyme binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0006629 lipid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0003674 molecular_function No
GO:0006082 organic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0048037 cofactor binding No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008610 lipid biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016229 steroid dehydrogenase activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0043436 oxoacid metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4181
MKIGENKTERNRDILNDDRKMHMENEPRFASECDCDYASYPIIPQPMQQLVADGAVEHGLLMPHSSCLDMSASTL
IRAAWALMASHLTNSKRVVFGTTIYGRRATVIGLEVSAPTVTAVAVHAQWQGNQTVSDYLQAVRQAAVQAPAKQT
DVGRVECMFQTLLDVQSHDHHHIHGRGQRGCQEYALVLEIAVGRHQATAKARFDSRVVAPWAVRKLLEQLEFVLG
QLVNADPERMLAEIEVLTPQDLDAIWGWNRTVPAPVERCVHDLIQDVVQTQPNAPAVCAWDGELTYGELDRLAVC
VAARLVDLGVGPNVLVPLCFDKSMWTIVAKLGVLKAGGAFILLDPSLPEQRLRAIVGELRAGLLLSSASTRELGL
RLVPEVVTLSSDLLLTDLASHDAVAASPDAVMYVIFTSGSTGTPKGVIITHSNFASALHHQLGSLGITSASRLFD
FAAYSFDISISNAFRTLAAGGCLCIPNEQDRRNCLVQSIASLQANAVHFTPSVAQLLVLDDAAELQTIFLGGETV
RVRDIKPWWDKVRLVHEYGPSECTPTSTINCNKSTPEEAARIGTGAGLVTWVVNAEDHNKLVPLGFVGELLLEGP
LVGRGYLNDADKTASAFIEDTPWLLRGTASCPGRHGRLYKTGDLVRYNEDGSLTFVCRKDQQVKIRGQRVELGDI
EHHVKQLIPEAEQVVAEVIKLQDEDGRPVLVAFIQMSRQADEVDNASVKLLHVAAVVKKRLTERLPSYMVPTVFF
AMAKLPMTSSGKMNRTRLREIGQSILVDGVEQAHQSSRRAAHNAKNGTPMSETEHPVYALAEKVLAMLPPAHRRG
LLPNGRDGIGTGIDFDNVPLSLCGLDSVNMMSLIHFIRRQFQVMIDMRLLMNGRTSIRSLGEHVMNLQVGALNGC
TEAPTSVDLLTEISQYDSMIAAAQLEAPLSVETKSRDDLTILLTGANGFIGTQILRQLLNHNKVAAVIALVRGET
EDGARKRTIDAAKKARWWAQDYEKKLHVWLGDLGSPRLGRNASDWSLLGHKIDAVIHNGATVHLGKSYAQLKAAN
VGSTADLLRLIAAKPSVKFVYVSTLRHRTSMSETEDDAARLLANSIGYNQTKFVAEALVRRAALRCAPGSNHLVA
LCPGFVIGTPNEGVANAGDHFWRLVAACIKVGAYNADEADGWVYVSDVMSTVKYIVEAALEPGALPKAVAHVSDG
ITWRHFWDLVRGIGYPIQARHAAEWLAAVRQDIELGGEAHPMWPLAHMLENRVTQQASHENGLTPKSLKVAVTKN
IEYLASVGFLPLAVPGVLDATADNKASLSSGWHHQLCGNRLGDEIEHLAWSHSNEASNDLRSDTCTKPTLPMLEA
IIKTSLGDNDMEEDPTTNSFQSYVAELLGHEASLLVASGTMGNQVALRTVLSAPPYSILADHRGHIITLEGGGAS
TVCGAMIKMVVPCNGHHLTLADVQRNCTLTETVYDCPTRVISLENTLEGTIMPLCDIRAISKWARAKEPPIHMHL
DGARLWEAVAAGTCTLREIGECFDSIQLCLSKGIGAPIGSVVVGSSVFIQRAKWSRKLLGGSIRAAGLVAAPARV
AIDTVFLGNMLKHAHDKARRASALWEQLGGKLRTPTETNMVWPDLEASGLAHDDFYPVAKKFGLKVWDLMSGRLV
FHYQITDDTFARLCDFFHAVLEKKPGRI*
Coding >OphauB2|4181
ATGAAAATTGGTGAGAATAAGACAGAGAGAAACAGAGACATCTTGAACGACGACAGGAAAATGCACATGGAGAAT
GAGCCAAGGTTTGCAAGCGAGTGCGATTGTGACTATGCATCGTACCCCATCATCCCTCAGCCTATGCAACAACTC
GTGGCAGATGGGGCGGTGGAACATGGGCTGCTAATGCCACATAGCTCATGTCTTGACATGTCGGCATCGACTCTG
ATTCGTGCGGCCTGGGCGCTAATGGCAAGCCACTTGACAAACTCTAAGCGCGTCGTCTTCGGCACCACCATTTAC
GGTAGGCGCGCAACCGTTATTGGTCTTGAAGTCTCTGCTCCTACAGTAACGGCAGTGGCGGTGCATGCCCAGTGG
CAAGGCAACCAGACTGTCTCGGACTATCTTCAAGCAGTGCGTCAGGCAGCGGTGCAAGCTCCCGCAAAACAGACC
GACGTTGGTCGGGTCGAATGCATGTTTCAGACACTGCTCGACGTCCAATCGCATGACCACCACCACATCCACGGG
AGGGGGCAGAGGGGCTGCCAAGAGTATGCCCTTGTGCTAGAGATAGCTGTTGGCCGGCATCAGGCAACGGCCAAG
GCTAGGTTCGACTCGAGAGTCGTGGCACCATGGGCGGTGCGGAAGTTGCTTGAACAGCTCGAGTTTGTGTTGGGG
CAGCTTGTCAATGCAGATCCGGAGCGGATGCTAGCCGAGATCGAGGTGCTCACACCGCAGGATCTAGATGCGATA
TGGGGCTGGAATCGCACGGTGCCAGCGCCAGTTGAGCGGTGTGTCCACGACCTAATTCAGGATGTGGTGCAAACG
CAGCCCAACGCCCCAGCCGTATGTGCCTGGGACGGCGAGCTGACGTACGGCGAGCTGGACCGGCTTGCCGTTTGC
GTCGCGGCCCGCTTGGTTGACCTGGGCGTTGGGCCCAACGTTTTGGTTCCCCTTTGCTTCGACAAGTCCATGTGG
ACCATTGTAGCCAAGCTCGGCGTGCTTAAAGCGGGCGGCGCCTTCATATTGCTTGACCCGTCGCTTCCCGAGCAG
CGACTGCGGGCTATTGTTGGCGAGCTTCGGGCTGGTCTGCTGCTGTCCTCGGCCTCGACGCGAGAGCTTGGCCTG
CGTCTGGTGCCCGAGGTGGTGACGTTGAGCTCCGACCTGCTGTTGACGGATTTGGCCAGCCACGATGCCGTGGCC
GCTAGCCCAGATGCCGTCATGTACGTCATCTTCACGTCGGGCAGTACTGGGACCCCAAAGGGCGTCATCATCACC
CACAGCAACTTTGCATCGGCCCTTCATCATCAGCTTGGCAGCCTTGGCATTACTTCGGCATCCAGACTTTTCGAC
TTTGCAGCCTACAGCTTCGACATTTCGATTAGTAATGCGTTTCGAACTCTGGCCGCAGGCGGCTGTCTCTGTATT
CCCAACGAGCAGGATAGGAGGAACTGTCTGGTGCAAAGCATAGCATCTCTCCAAGCTAATGCAGTTCACTTTACG
CCCTCGGTCGCCCAGCTGCTAGTTCTCGATGATGCGGCGGAGCTACAGACCATATTCCTAGGCGGAGAGACGGTA
CGCGTCCGAGACATCAAGCCTTGGTGGGACAAGGTGCGTCTTGTTCACGAGTACGGGCCTAGTGAATGCACTCCA
ACCAGCACCATCAATTGCAATAAGTCAACGCCTGAGGAGGCCGCCCGCATTGGCACCGGCGCAGGACTAGTGACG
TGGGTCGTCAATGCCGAGGACCACAACAAGCTTGTCCCTCTAGGCTTCGTTGGCGAATTGCTACTCGAAGGACCG
CTTGTTGGTCGCGGCTATCTAAACGACGCCGACAAGACGGCATCGGCATTTATCGAGGATACCCCCTGGCTGTTG
CGAGGCACGGCGTCTTGTCCAGGGCGACATGGGCGTCTCTATAAGACTGGAGACCTAGTACGATATAATGAGGAT
GGGAGTTTGACCTTTGTCTGCCGCAAGGACCAGCAAGTCAAGATCCGTGGTCAGCGGGTTGAGCTTGGAGACATT
GAACATCATGTCAAGCAACTCATACCCGAAGCGGAACAGGTTGTGGCCGAAGTCATCAAGCTGCAAGACGAAGAT
GGGAGACCGGTGCTCGTCGCCTTTATTCAGATGTCAAGGCAGGCTGATGAGGTCGACAATGCTTCCGTCAAGTTG
CTCCACGTTGCGGCTGTGGTCAAGAAGCGACTCACGGAGCGTCTGCCAAGTTACATGGTGCCGACAGTCTTCTTC
GCCATGGCCAAGCTGCCCATGACGTCTTCGGGGAAAATGAATCGGACAAGACTCCGTGAGATTGGTCAGTCCATT
CTCGTGGATGGAGTCGAACAAGCACACCAGTCATCGAGACGAGCTGCCCATAATGCCAAGAATGGTACGCCCATG
TCTGAAACTGAGCACCCAGTCTATGCGCTGGCCGAGAAGGTCCTTGCAATGCTTCCTCCGGCGCATCGGCGTGGC
CTGCTGCCCAATGGCCGAGATGGCATTGGCACTGGCATCGACTTTGACAATGTGCCGTTGAGCCTCTGCGGACTA
GACTCGGTCAACATGATGTCGCTGATACACTTTATTCGGCGACAGTTCCAAGTCATGATTGACATGCGGCTGCTA
ATGAATGGTCGAACCAGCATCCGCAGCCTGGGTGAACATGTGATGAATCTTCAAGTGGGCGCCCTAAACGGCTGC
ACTGAGGCACCAACCTCGGTCGACCTCTTGACCGAGATTAGTCAGTATGACTCGATGATTGCCGCTGCCCAGCTA
GAGGCACCACTGTCTGTCGAGACAAAGTCTCGTGACGACTTGACCATTCTCCTGACTGGCGCCAACGGCTTCATT
GGCACCCAAATCCTCCGCCAACTCTTAAATCATAACAAGGTTGCCGCCGTCATCGCCCTCGTGCGCGGAGAGACA
GAAGATGGAGCTCGAAAGCGCACCATTGACGCGGCCAAGAAGGCTCGCTGGTGGGCTCAGGACTACGAAAAGAAG
CTTCATGTCTGGTTGGGTGACCTTGGCTCGCCACGTCTGGGGCGTAATGCATCAGACTGGAGCCTTCTTGGCCAC
AAGATTGATGCCGTCATCCATAATGGTGCCACAGTTCACTTGGGTAAAAGCTATGCCCAACTCAAAGCCGCCAAC
GTGGGCTCGACGGCTGATCTGCTTCGACTCATCGCGGCCAAACCTTCTGTCAAGTTTGTCTATGTTTCAACGCTT
CGACATCGCACATCAATGAGCGAGACTGAAGATGACGCAGCAAGACTTCTTGCTAATTCCATCGGCTACAACCAA
ACCAAGTTTGTTGCCGAAGCACTGGTCCGGCGCGCAGCCCTACGTTGCGCTCCGGGGTCAAACCATCTGGTTGCT
CTATGTCCGGGTTTTGTCATTGGTACACCCAACGAGGGCGTCGCCAATGCCGGAGATCATTTCTGGCGGCTAGTG
GCGGCCTGCATCAAGGTGGGCGCGTACAATGCCGACGAAGCCGACGGATGGGTCTATGTTTCGGATGTCATGTCC
ACGGTAAAATACATTGTCGAGGCGGCCCTGGAGCCAGGAGCGTTGCCCAAGGCGGTGGCTCATGTTTCGGATGGC
ATTACATGGCGTCATTTCTGGGATCTTGTTCGCGGAATTGGCTATCCAATCCAAGCTCGACACGCTGCCGAGTGG
CTGGCTGCTGTTCGCCAAGATATCGAACTTGGTGGAGAGGCACATCCCATGTGGCCGCTGGCTCACATGCTCGAG
AACAGAGTCACACAGCAAGCTAGCCATGAAAACGGCCTTACTCCCAAGAGCTTGAAGGTAGCCGTGACAAAAAAC
ATCGAATATCTAGCCAGCGTAGGTTTTTTGCCCTTGGCCGTCCCGGGAGTATTGGATGCCACTGCAGACAACAAG
GCTTCCTTGAGCTCTGGATGGCATCACCAGCTCTGCGGTAATCGCCTTGGAGACGAGATAGAACATCTGGCATGG
TCACATAGCAACGAGGCGTCCAACGACCTCCGGTCAGATACCTGCACCAAGCCTACGTTGCCTATGCTAGAAGCC
ATCATCAAGACGTCACTGGGAGACAACGATATGGAGGAAGACCCGACGACGAATTCGTTCCAGAGCTACGTGGCC
GAATTGCTAGGCCACGAGGCCTCTCTTCTTGTGGCCTCGGGCACCATGGGCAACCAGGTAGCTCTCAGAACCGTG
CTTAGTGCCCCGCCGTACTCGATCCTCGCCGACCATCGCGGCCACATCATCACACTCGAGGGCGGTGGTGCATCT
ACCGTTTGTGGCGCCATGATCAAAATGGTCGTGCCGTGCAACGGCCACCACCTCACACTGGCTGATGTCCAACGC
AACTGTACCCTGACTGAAACTGTCTATGACTGCCCAACCAGGGTCATTAGCCTGGAGAATACGCTAGAGGGCACA
ATTATGCCGCTCTGCGACATTCGCGCCATCTCCAAGTGGGCGCGCGCCAAGGAGCCGCCCATCCACATGCATCTC
GACGGAGCTCGCCTGTGGGAAGCAGTTGCGGCCGGAACCTGCACGCTTCGCGAAATCGGAGAATGCTTTGATAGC
ATCCAGCTGTGCCTGTCCAAGGGTATCGGCGCTCCTATTGGCAGCGTCGTGGTAGGCAGCTCTGTTTTTATTCAG
CGCGCCAAATGGAGCCGCAAGCTTCTAGGTGGTAGCATCCGCGCTGCCGGTTTGGTTGCTGCGCCTGCACGCGTC
GCCATTGACACCGTCTTCCTCGGTAATATGCTGAAGCATGCACATGACAAGGCCAGGCGTGCCTCGGCCCTATGG
GAACAGCTCGGGGGAAAGCTGCGCACTCCAACCGAAACCAACATGGTCTGGCCCGACCTGGAAGCATCGGGCTTG
GCACATGACGACTTTTATCCCGTGGCTAAGAAGTTTGGCCTCAAGGTTTGGGATCTCATGTCCGGACGGCTCGTC
TTTCATTACCAAATCACCGACGACACATTTGCCAGACTATGCGATTTTTTCCACGCTGTTCTTGAGAAGAAGCCC
GGTCGTATATAG
Transcript >OphauB2|4181
ATGAAAATTGGTGAGAATAAGACAGAGAGAAACAGAGACATCTTGAACGACGACAGGAAAATGCACATGGAGAAT
GAGCCAAGGTTTGCAAGCGAGTGCGATTGTGACTATGCATCGTACCCCATCATCCCTCAGCCTATGCAACAACTC
GTGGCAGATGGGGCGGTGGAACATGGGCTGCTAATGCCACATAGCTCATGTCTTGACATGTCGGCATCGACTCTG
ATTCGTGCGGCCTGGGCGCTAATGGCAAGCCACTTGACAAACTCTAAGCGCGTCGTCTTCGGCACCACCATTTAC
GGTAGGCGCGCAACCGTTATTGGTCTTGAAGTCTCTGCTCCTACAGTAACGGCAGTGGCGGTGCATGCCCAGTGG
CAAGGCAACCAGACTGTCTCGGACTATCTTCAAGCAGTGCGTCAGGCAGCGGTGCAAGCTCCCGCAAAACAGACC
GACGTTGGTCGGGTCGAATGCATGTTTCAGACACTGCTCGACGTCCAATCGCATGACCACCACCACATCCACGGG
AGGGGGCAGAGGGGCTGCCAAGAGTATGCCCTTGTGCTAGAGATAGCTGTTGGCCGGCATCAGGCAACGGCCAAG
GCTAGGTTCGACTCGAGAGTCGTGGCACCATGGGCGGTGCGGAAGTTGCTTGAACAGCTCGAGTTTGTGTTGGGG
CAGCTTGTCAATGCAGATCCGGAGCGGATGCTAGCCGAGATCGAGGTGCTCACACCGCAGGATCTAGATGCGATA
TGGGGCTGGAATCGCACGGTGCCAGCGCCAGTTGAGCGGTGTGTCCACGACCTAATTCAGGATGTGGTGCAAACG
CAGCCCAACGCCCCAGCCGTATGTGCCTGGGACGGCGAGCTGACGTACGGCGAGCTGGACCGGCTTGCCGTTTGC
GTCGCGGCCCGCTTGGTTGACCTGGGCGTTGGGCCCAACGTTTTGGTTCCCCTTTGCTTCGACAAGTCCATGTGG
ACCATTGTAGCCAAGCTCGGCGTGCTTAAAGCGGGCGGCGCCTTCATATTGCTTGACCCGTCGCTTCCCGAGCAG
CGACTGCGGGCTATTGTTGGCGAGCTTCGGGCTGGTCTGCTGCTGTCCTCGGCCTCGACGCGAGAGCTTGGCCTG
CGTCTGGTGCCCGAGGTGGTGACGTTGAGCTCCGACCTGCTGTTGACGGATTTGGCCAGCCACGATGCCGTGGCC
GCTAGCCCAGATGCCGTCATGTACGTCATCTTCACGTCGGGCAGTACTGGGACCCCAAAGGGCGTCATCATCACC
CACAGCAACTTTGCATCGGCCCTTCATCATCAGCTTGGCAGCCTTGGCATTACTTCGGCATCCAGACTTTTCGAC
TTTGCAGCCTACAGCTTCGACATTTCGATTAGTAATGCGTTTCGAACTCTGGCCGCAGGCGGCTGTCTCTGTATT
CCCAACGAGCAGGATAGGAGGAACTGTCTGGTGCAAAGCATAGCATCTCTCCAAGCTAATGCAGTTCACTTTACG
CCCTCGGTCGCCCAGCTGCTAGTTCTCGATGATGCGGCGGAGCTACAGACCATATTCCTAGGCGGAGAGACGGTA
CGCGTCCGAGACATCAAGCCTTGGTGGGACAAGGTGCGTCTTGTTCACGAGTACGGGCCTAGTGAATGCACTCCA
ACCAGCACCATCAATTGCAATAAGTCAACGCCTGAGGAGGCCGCCCGCATTGGCACCGGCGCAGGACTAGTGACG
TGGGTCGTCAATGCCGAGGACCACAACAAGCTTGTCCCTCTAGGCTTCGTTGGCGAATTGCTACTCGAAGGACCG
CTTGTTGGTCGCGGCTATCTAAACGACGCCGACAAGACGGCATCGGCATTTATCGAGGATACCCCCTGGCTGTTG
CGAGGCACGGCGTCTTGTCCAGGGCGACATGGGCGTCTCTATAAGACTGGAGACCTAGTACGATATAATGAGGAT
GGGAGTTTGACCTTTGTCTGCCGCAAGGACCAGCAAGTCAAGATCCGTGGTCAGCGGGTTGAGCTTGGAGACATT
GAACATCATGTCAAGCAACTCATACCCGAAGCGGAACAGGTTGTGGCCGAAGTCATCAAGCTGCAAGACGAAGAT
GGGAGACCGGTGCTCGTCGCCTTTATTCAGATGTCAAGGCAGGCTGATGAGGTCGACAATGCTTCCGTCAAGTTG
CTCCACGTTGCGGCTGTGGTCAAGAAGCGACTCACGGAGCGTCTGCCAAGTTACATGGTGCCGACAGTCTTCTTC
GCCATGGCCAAGCTGCCCATGACGTCTTCGGGGAAAATGAATCGGACAAGACTCCGTGAGATTGGTCAGTCCATT
CTCGTGGATGGAGTCGAACAAGCACACCAGTCATCGAGACGAGCTGCCCATAATGCCAAGAATGGTACGCCCATG
TCTGAAACTGAGCACCCAGTCTATGCGCTGGCCGAGAAGGTCCTTGCAATGCTTCCTCCGGCGCATCGGCGTGGC
CTGCTGCCCAATGGCCGAGATGGCATTGGCACTGGCATCGACTTTGACAATGTGCCGTTGAGCCTCTGCGGACTA
GACTCGGTCAACATGATGTCGCTGATACACTTTATTCGGCGACAGTTCCAAGTCATGATTGACATGCGGCTGCTA
ATGAATGGTCGAACCAGCATCCGCAGCCTGGGTGAACATGTGATGAATCTTCAAGTGGGCGCCCTAAACGGCTGC
ACTGAGGCACCAACCTCGGTCGACCTCTTGACCGAGATTAGTCAGTATGACTCGATGATTGCCGCTGCCCAGCTA
GAGGCACCACTGTCTGTCGAGACAAAGTCTCGTGACGACTTGACCATTCTCCTGACTGGCGCCAACGGCTTCATT
GGCACCCAAATCCTCCGCCAACTCTTAAATCATAACAAGGTTGCCGCCGTCATCGCCCTCGTGCGCGGAGAGACA
GAAGATGGAGCTCGAAAGCGCACCATTGACGCGGCCAAGAAGGCTCGCTGGTGGGCTCAGGACTACGAAAAGAAG
CTTCATGTCTGGTTGGGTGACCTTGGCTCGCCACGTCTGGGGCGTAATGCATCAGACTGGAGCCTTCTTGGCCAC
AAGATTGATGCCGTCATCCATAATGGTGCCACAGTTCACTTGGGTAAAAGCTATGCCCAACTCAAAGCCGCCAAC
GTGGGCTCGACGGCTGATCTGCTTCGACTCATCGCGGCCAAACCTTCTGTCAAGTTTGTCTATGTTTCAACGCTT
CGACATCGCACATCAATGAGCGAGACTGAAGATGACGCAGCAAGACTTCTTGCTAATTCCATCGGCTACAACCAA
ACCAAGTTTGTTGCCGAAGCACTGGTCCGGCGCGCAGCCCTACGTTGCGCTCCGGGGTCAAACCATCTGGTTGCT
CTATGTCCGGGTTTTGTCATTGGTACACCCAACGAGGGCGTCGCCAATGCCGGAGATCATTTCTGGCGGCTAGTG
GCGGCCTGCATCAAGGTGGGCGCGTACAATGCCGACGAAGCCGACGGATGGGTCTATGTTTCGGATGTCATGTCC
ACGGTAAAATACATTGTCGAGGCGGCCCTGGAGCCAGGAGCGTTGCCCAAGGCGGTGGCTCATGTTTCGGATGGC
ATTACATGGCGTCATTTCTGGGATCTTGTTCGCGGAATTGGCTATCCAATCCAAGCTCGACACGCTGCCGAGTGG
CTGGCTGCTGTTCGCCAAGATATCGAACTTGGTGGAGAGGCACATCCCATGTGGCCGCTGGCTCACATGCTCGAG
AACAGAGTCACACAGCAAGCTAGCCATGAAAACGGCCTTACTCCCAAGAGCTTGAAGGTAGCCGTGACAAAAAAC
ATCGAATATCTAGCCAGCGTAGGTTTTTTGCCCTTGGCCGTCCCGGGAGTATTGGATGCCACTGCAGACAACAAG
GCTTCCTTGAGCTCTGGATGGCATCACCAGCTCTGCGGTAATCGCCTTGGAGACGAGATAGAACATCTGGCATGG
TCACATAGCAACGAGGCGTCCAACGACCTCCGGTCAGATACCTGCACCAAGCCTACGTTGCCTATGCTAGAAGCC
ATCATCAAGACGTCACTGGGAGACAACGATATGGAGGAAGACCCGACGACGAATTCGTTCCAGAGCTACGTGGCC
GAATTGCTAGGCCACGAGGCCTCTCTTCTTGTGGCCTCGGGCACCATGGGCAACCAGGTAGCTCTCAGAACCGTG
CTTAGTGCCCCGCCGTACTCGATCCTCGCCGACCATCGCGGCCACATCATCACACTCGAGGGCGGTGGTGCATCT
ACCGTTTGTGGCGCCATGATCAAAATGGTCGTGCCGTGCAACGGCCACCACCTCACACTGGCTGATGTCCAACGC
AACTGTACCCTGACTGAAACTGTCTATGACTGCCCAACCAGGGTCATTAGCCTGGAGAATACGCTAGAGGGCACA
ATTATGCCGCTCTGCGACATTCGCGCCATCTCCAAGTGGGCGCGCGCCAAGGAGCCGCCCATCCACATGCATCTC
GACGGAGCTCGCCTGTGGGAAGCAGTTGCGGCCGGAACCTGCACGCTTCGCGAAATCGGAGAATGCTTTGATAGC
ATCCAGCTGTGCCTGTCCAAGGGTATCGGCGCTCCTATTGGCAGCGTCGTGGTAGGCAGCTCTGTTTTTATTCAG
CGCGCCAAATGGAGCCGCAAGCTTCTAGGTGGTAGCATCCGCGCTGCCGGTTTGGTTGCTGCGCCTGCACGCGTC
GCCATTGACACCGTCTTCCTCGGTAATATGCTGAAGCATGCACATGACAAGGCCAGGCGTGCCTCGGCCCTATGG
GAACAGCTCGGGGGAAAGCTGCGCACTCCAACCGAAACCAACATGGTCTGGCCCGACCTGGAAGCATCGGGCTTG
GCACATGACGACTTTTATCCCGTGGCTAAGAAGTTTGGCCTCAAGGTTTGGGATCTCATGTCCGGACGGCTCGTC
TTTCATTACCAAATCACCGACGACACATTTGCCAGACTATGCGATTTTTTCCACGCTGTTCTTGAGAAGAAGCCC
GGTCGTATATAG
Gene >OphauB2|4181
ATGAAAATTGGTGAGAATAAGACAGAGAGAAACAGAGACATCTTGAACGACGACAGGAAAATGCACATGGAGAAT
GAGCCAAGGTTTGCAAGCGAGTGCGATTGTGACTATGCATCGTACCCCATCATCCCTCAGCCTATGCAACAACTC
GTGGCAGATGGGGCGGTGGAACATGGGCTGCTAATGCCACATAGCTCATGTCTTGACATGTCGGCATCGACTCTG
ATTCGTGCGGCCTGGGCGCTAATGGCAAGCCACTTGACAAACTCTAAGCGCGTCGTCTTCGGCACCACCATTTAC
GGTAGGCGCGCAACCGTTATTGGTCTTGAAGTCTCTGCTCCTACAGTAACGGCAGTGGCGGTGCATGCCCAGTGG
CAAGGCAACCAGACTGTCTCGGACTATCTTCAAGCAGTGCGTCAGGCAGCGGTGCAAGCTCCCGCAAAACAGACC
GACGTTGGTCGGGTCGAATGCATGTTTCAGACACTGCTCGACGTCCAATCGCATGACCACCACCACATCCACGGG
AGGGGGCAGAGGGGCTGCCAAGAGTATGCCCTTGTGCTAGAGATAGCTGTTGGCCGGCATCAGGCAACGGCCAAG
GCTAGGTTCGACTCGAGAGTCGTGGCACCATGGGCGGTGCGGAAGTTGCTTGAACAGCTCGAGTTTGTGTTGGGG
CAGCTTGTCAATGCAGATCCGGAGCGGATGCTAGCCGAGATCGAGGTGCTCACACCGCAGGATCTAGATGCGATA
TGGGGCTGGAATCGCACGGTGCCAGCGCCAGTTGAGCGGTGTGTCCACGACCTAATTCAGGATGTGGTGCAAACG
CAGCCCAACGCCCCAGCCGTATGTGCCTGGGACGGCGAGCTGACGTACGGCGAGCTGGACCGGCTTGCCGTTTGC
GTCGCGGCCCGCTTGGTTGACCTGGGCGTTGGGCCCAACGTTTTGGTTCCCCTTTGCTTCGACAAGTCCATGTGG
ACCATTGTAGCCAAGCTCGGCGTGCTTAAAGCGGGCGGCGCCTTCATATTGCTTGACCCGTCGCTTCCCGAGCAG
CGACTGCGGGCTATTGTTGGCGAGCTTCGGGCTGGTCTGCTGCTGTCCTCGGCCTCGACGCGAGAGCTTGGCCTG
CGTCTGGTGCCCGAGGTGGTGACGTTGAGCTCCGACCTGCTGTTGACGGATTTGGCCAGCCACGATGCCGTGGCC
GCTAGCCCAGATGCCGTCATGTACGTCATCTTCACGTCGGGCAGTACTGGGACCCCAAAGGGCGTCATCATCACC
CACAGCAACTTTGCATCGGCCCTTCATCATCAGCTTGGCAGCCTTGGCATTACTTCGGCATCCAGACTTTTCGAC
TTTGCAGCCTACAGCTTCGACATTTCGATTAGTAATGCGTTTCGAACTCTGGCCGCAGGCGGCTGTCTCTGTATT
CCCAACGAGCAGGATAGGAGGAACTGTCTGGTGCAAAGCATAGCATCTCTCCAAGCTAATGCAGTTCACTTTACG
CCCTCGGTCGCCCAGCTGCTAGTTCTCGATGATGCGGCGGAGCTACAGACCATATTCCTAGGCGGAGAGACGGTA
CGCGTCCGAGACATCAAGCCTTGGTGGGACAAGGTGCGTCTTGTTCACGAGTACGGGCCTAGTGAATGCACTCCA
ACCAGCACCATCAATTGCAATAAGTCAACGCCTGAGGAGGCCGCCCGCATTGGCACCGGCGCAGGACTAGTGACG
TGGGTCGTCAATGCCGAGGACCACAACAAGCTTGTCCCTCTAGGCTTCGTTGGCGAATTGCTACTCGAAGGACCG
CTTGTTGGTCGCGGCTATCTAAACGACGCCGACAAGACGGCATCGGCATTTATCGAGGATACCCCCTGGCTGTTG
CGAGGCACGGCGTCTTGTCCAGGGCGACATGGGCGTCTCTATAAGACTGGAGACCTAGTACGATATAATGAGGAT
GGGAGTTTGACCTTTGTCTGCCGCAAGGACCAGCAAGTCAAGATCCGTGGTCAGCGGGTTGAGCTTGGAGACATT
GAACATCATGTCAAGCAACTCATACCCGAAGCGGAACAGGTTGTGGCCGAAGTCATCAAGCTGCAAGACGAAGAT
GGGAGACCGGTGCTCGTCGCCTTTATTCAGATGTCAAGGCAGGCTGATGAGGTCGACAATGCTTCCGTCAAGTTG
CTCCACGTTGCGGCTGTGGTCAAGAAGCGACTCACGGAGCGTCTGCCAAGTTACATGGTGCCGACAGTCTTCTTC
GCCATGGCCAAGCTGCCCATGACGTCTTCGGGGAAAATGAATCGGACAAGACTCCGTGAGATTGGTCAGTCCATT
CTCGTGGATGGAGTCGAACAAGCACACCAGTCATCGAGACGAGCTGCCCATAATGCCAAGAATGGTACGCCCATG
TCTGAAACTGAGCACCCAGTCTATGCGCTGGCCGAGAAGGTCCTTGCAATGCTTCCTCCGGCGCATCGGCGTGGC
CTGCTGCCCAATGGCCGAGATGGCATTGGCACTGGCATCGACTTTGACAATGTGCCGTTGAGCCTCTGCGGACTA
GACTCGGTCAACATGATGTCGCTGATACACTTTATTCGGCGACAGTTCCAAGTCATGATTGACATGCGGCTGCTA
ATGAATGGTCGAACCAGCATCCGCAGCCTGGGTGAACATGTGATGAATCTTCAAGTGGGCGCCCTAAACGGCTGC
ACTGAGGCACCAACCTCGGTCGACCTCTTGACCGAGATTAGTCAGTATGACTCGATGATTGCCGCTGCCCAGCTA
GAGGCACCACTGTCTGTCGAGACAAAGTCTCGTGACGACTTGACCATTCTCCTGACTGGCGCCAACGGCTTCATT
GGCACCCAAATCCTCCGCCAACTCTTAAATCATAACAAGGTTGCCGCCGTCATCGCCCTCGTGCGCGGAGAGACA
GAAGATGGAGCTCGAAAGCGCACCATTGACGCGGCCAAGAAGGCTCGCTGGTGGGCTCAGGACTACGAAAAGAAG
CTTCATGTCTGGTTGGGTGACCTTGGCTCGCCACGTCTGGGGCGTAATGCATCAGACTGGAGCCTTCTTGGCCAC
AAGATTGATGCCGTCATCCATAATGGTGCCACAGTTCACTTGGGTAAAAGCTATGCCCAACTCAAAGCCGCCAAC
GTGGGCTCGACGGCTGATCTGCTTCGACTCATCGCGGCCAAACCTTCTGTCAAGTTTGTCTATGTTTCAACGCTT
CGACATCGCACATCAATGAGCGAGACTGAAGATGACGCAGCAAGACTTCTTGCTAATTCCATCGGCTACAACCAA
ACCAAGTTTGTTGCCGAAGCACTGGTCCGGCGCGCAGCCCTACGTTGCGCTCCGGGGTCAAACCATCTGGTTGCT
CTATGTCCGGGTTTTGTCATTGGTACACCCAACGAGGGCGTCGCCAATGCCGGAGATCATTTCTGGCGGCTAGTG
GCGGCCTGCATCAAGGTGGGCGCGTACAATGCCGACGAAGCCGACGGATGGGTCTATGTTTCGGATGTCATGTCC
ACGGTAAAATACATTGTCGAGGCGGCCCTGGAGCCAGGAGCGTTGCCCAAGGCGGTGGCTCATGTTTCGGATGGC
ATTACATGGCGTCATTTCTGGGATCTTGTTCGCGGAATTGGCTATCCAATCCAAGCTCGACACGCTGCCGAGTGG
CTGGCTGCTGTTCGCCAAGATATCGAACTTGGTGGAGAGGCACATCCCATGTGGCCGCTGGCTCACATGCTCGAG
AACAGAGTCACACAGCAAGCTAGCCATGAAAACGGCCTTACTCCCAAGAGCTTGAAGGTAGCCGTGACAAAAAAC
ATCGAATATCTAGCCAGCGTAGGTTTTTTGCCCTTGGCCGTCCCGGGAGTATTGGATGCCACTGCAGACAACAAG
GCTTCCTTGAGCTCTGGATGGCATCACCAGCTCTGCGGTAATCGCCTTGGAGACGAGATAGAACATCTGGCATGG
TCACATAGCAACGAGGCGTCCAACGACCTCCGGTCAGATACCTGCACCAAGCCTACGTTGCCTATGCTAGAAGCC
ATCATCAAGACGTCACTGGGAGACAACGATATGGAGGAAGACCCGACGACGAATTCGTTCCAGAGCTACGTGGCC
GAATTGCTAGGCCACGAGGCCTCTCTTCTTGTGGCCTCGGGCACCATGGGCAACCAGGTAGCTCTCAGAACCGTG
CTTAGTGCCCCGCCGTACTCGATCCTCGCCGACCATCGCGGCCACATCATCACACTCGAGGGCGGTGGTGCATCT
ACCGTTTGTGGCGCCATGATCAAAATGGTCGTGCCGTGCAACGGCCACCACCTCACACTGGCTGATGTCCAACGC
AACTGTACCCTGACTGAAACTGTCTATGACTGCCCAACCAGGGTCATTAGCCTGGAGAATACGCTAGAGGGCACA
ATTATGCCGCTCTGCGACATTCGCGCCATCTCCAAGTGGGCGCGCGCCAAGGAGCCGCCCATCCACATGCATCTC
GACGGAGCTCGCCTGTGGGAAGCAGTTGCGGCCGGAACCTGCACGCTTCGCGAAATCGGAGAATGCTTTGATAGC
ATCCAGCTGTGCCTGTCCAAGGGTATCGGCGCTCCTATTGGCAGCGTCGTGGTAGGCAGCTCTGTTTTTATTCAG
CGCGCCAAATGGAGCCGCAAGCTTCTAGGTGGTAGCATCCGCGCTGCCGGTTTGGTTGCTGCGCCTGCACGCGTC
GCCATTGACACCGTCTTCCTCGGTAATATGCTGAAGCATGCACATGACAAGGCCAGGCGTGCCTCGGCCCTATGG
GAACAGCTCGGGGGAAAGCTGCGCACTCCAACCGAAACCAACATGGTCTGGCCCGACCTGGAAGCATCGGGCTTG
GCACATGACGACTTTTATCCCGTGGCTAAGAAGTTTGGCCTCAAGGTTTGGGATCTCATGTCCGGACGGCTCGTC
TTTCATTACCAAATCACCGACGACACATTTGCCAGACTATGCGATTTTTTCCACGCTGTTCTTGAGAAGAAGCCC
GGTCGTATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail