Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4180
Gene name
LocationContig_277:1559..3005
Strand-
Gene length (bp)1446
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.8E-18 54 290

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 18 351 7.0E-21
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 38 239 6.0E-17
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 59 250 3.0E-16
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 6 257 1.0E-15
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 55 203 3.0E-07

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 113 135 22
3 142 159 17
4 174 193 19
5 214 236 22
6 283 305 22
7 345 367 22
8 377 399 22
9 412 434 22
10 449 471 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4180
MKRDPRSTLHHEVGRVASQTTPLLRNDESRGTPAGKPLPTFQILLLCYARLMELIAQYSVYPYIAQMIQRNQHLR
QSDVGLYSGLVESIFTVAETAVLALWCYLADHIGRKSALVFSLIGMAVGPVLFGVASSIAEMMLYRCLGGAFSGA
GLIIRTMIGDHTTSETQAVAYSWFAMADNLGAFVGLIIGGALADPVTQYPNVFGNVKFFQDYPYALPGIVIGIMN
STAAITSTIFLQETLDKKTAETHNHASPDPRAATQPWGFRQLAHIPGLYVALSVYGQVMLLRALIAAVLPVALYT
PVFLGGINCTPSQISLYMGSQATSQSFWFLLAFPWLQARMGTKAVLRLCSIGYPLVFMGYILMNLSLREGSHASF
AWFWVFTALTAFVGPAVFISLIAAQLVINDLSPDPHLLGSLNALAMMVHNVIQIAAPIFATTMYAVGVRGQVAYG
YLGWLVCIPIPLGLFLVVKWLPNSKETSCHG*
Coding >OphauB2|4180
ATGAAACGTGACCCAAGGTCGACATTGCATCACGAGGTCGGCCGTGTGGCCTCCCAAACCACGCCCCTACTGAGA
AATGATGAATCTCGCGGCACGCCTGCGGGAAAGCCATTGCCCACATTCCAGATCCTTCTCCTATGCTATGCTCGG
CTGATGGAGCTTATTGCGCAGTATTCTGTGTACCCTTATATCGCGCAAATGATTCAGCGCAACCAGCATCTGCGC
CAATCCGACGTTGGGCTCTACAGCGGGCTCGTCGAGTCCATCTTCACCGTTGCCGAGACGGCAGTCTTGGCACTC
TGGTGCTACCTGGCGGACCACATTGGCCGCAAGTCGGCTCTCGTCTTCAGCCTCATCGGCATGGCAGTTGGACCC
GTGTTGTTTGGTGTAGCGAGTAGCATTGCCGAGATGATGTTATACCGATGTCTTGGCGGCGCTTTTTCCGGTGCG
GGACTTATTATTCGAACCATGATTGGCGACCATACAACCTCTGAGACGCAAGCTGTGGCCTACAGCTGGTTCGCC
ATGGCTGACAACCTGGGCGCCTTTGTGGGGCTGATAATCGGCGGTGCGCTTGCCGATCCTGTTACACAGTACCCC
AATGTCTTTGGCAATGTCAAGTTCTTCCAAGACTACCCATATGCCCTCCCTGGTATTGTCATTGGCATCATGAAC
TCAACGGCAGCTATTACTTCCACCATCTTTCTCCAAGAGACACTGGACAAGAAGACGGCCGAGACTCACAACCAT
GCATCTCCAGATCCACGTGCCGCAACACAGCCATGGGGTTTTCGGCAGCTAGCACATATACCGGGCCTATACGTA
GCCCTATCAGTATATGGTCAAGTCATGCTATTGAGGGCCTTGATAGCCGCTGTTCTTCCAGTTGCACTCTATACT
CCAGTGTTTCTGGGAGGTATAAACTGTACGCCGTCCCAGATATCGCTATACATGGGGAGCCAGGCCACCAGCCAG
TCGTTTTGGTTTCTACTTGCCTTTCCCTGGCTGCAGGCTCGCATGGGAACCAAGGCTGTCTTACGTCTATGTTCT
ATTGGCTACCCTCTGGTTTTCATGGGGTATATCCTTATGAATCTGTCTTTGCGTGAGGGAAGTCATGCATCTTTT
GCTTGGTTTTGGGTCTTCACGGCACTTACCGCATTTGTTGGACCAGCCGTCTTTATATCCCTCATTGCTGCACAG
CTCGTTATTAACGACCTCTCACCGGACCCGCACCTTCTTGGAAGCCTCAATGCTCTGGCCATGATGGTCCACAAC
GTTATCCAGATTGCAGCTCCTATTTTTGCAACTACAATGTACGCCGTTGGGGTTCGGGGTCAGGTAGCCTACGGG
TACCTTGGCTGGCTAGTTTGCATCCCGATACCTTTGGGCCTCTTTTTAGTCGTCAAGTGGCTTCCAAATAGCAAG
GAGACAAGTTGCCACGGATAG
Transcript >OphauB2|4180
ATGAAACGTGACCCAAGGTCGACATTGCATCACGAGGTCGGCCGTGTGGCCTCCCAAACCACGCCCCTACTGAGA
AATGATGAATCTCGCGGCACGCCTGCGGGAAAGCCATTGCCCACATTCCAGATCCTTCTCCTATGCTATGCTCGG
CTGATGGAGCTTATTGCGCAGTATTCTGTGTACCCTTATATCGCGCAAATGATTCAGCGCAACCAGCATCTGCGC
CAATCCGACGTTGGGCTCTACAGCGGGCTCGTCGAGTCCATCTTCACCGTTGCCGAGACGGCAGTCTTGGCACTC
TGGTGCTACCTGGCGGACCACATTGGCCGCAAGTCGGCTCTCGTCTTCAGCCTCATCGGCATGGCAGTTGGACCC
GTGTTGTTTGGTGTAGCGAGTAGCATTGCCGAGATGATGTTATACCGATGTCTTGGCGGCGCTTTTTCCGGTGCG
GGACTTATTATTCGAACCATGATTGGCGACCATACAACCTCTGAGACGCAAGCTGTGGCCTACAGCTGGTTCGCC
ATGGCTGACAACCTGGGCGCCTTTGTGGGGCTGATAATCGGCGGTGCGCTTGCCGATCCTGTTACACAGTACCCC
AATGTCTTTGGCAATGTCAAGTTCTTCCAAGACTACCCATATGCCCTCCCTGGTATTGTCATTGGCATCATGAAC
TCAACGGCAGCTATTACTTCCACCATCTTTCTCCAAGAGACACTGGACAAGAAGACGGCCGAGACTCACAACCAT
GCATCTCCAGATCCACGTGCCGCAACACAGCCATGGGGTTTTCGGCAGCTAGCACATATACCGGGCCTATACGTA
GCCCTATCAGTATATGGTCAAGTCATGCTATTGAGGGCCTTGATAGCCGCTGTTCTTCCAGTTGCACTCTATACT
CCAGTGTTTCTGGGAGGTATAAACTGTACGCCGTCCCAGATATCGCTATACATGGGGAGCCAGGCCACCAGCCAG
TCGTTTTGGTTTCTACTTGCCTTTCCCTGGCTGCAGGCTCGCATGGGAACCAAGGCTGTCTTACGTCTATGTTCT
ATTGGCTACCCTCTGGTTTTCATGGGGTATATCCTTATGAATCTGTCTTTGCGTGAGGGAAGTCATGCATCTTTT
GCTTGGTTTTGGGTCTTCACGGCACTTACCGCATTTGTTGGACCAGCCGTCTTTATATCCCTCATTGCTGCACAG
CTCGTTATTAACGACCTCTCACCGGACCCGCACCTTCTTGGAAGCCTCAATGCTCTGGCCATGATGGTCCACAAC
GTTATCCAGATTGCAGCTCCTATTTTTGCAACTACAATGTACGCCGTTGGGGTTCGGGGTCAGGTAGCCTACGGG
TACCTTGGCTGGCTAGTTTGCATCCCGATACCTTTGGGCCTCTTTTTAGTCGTCAAGTGGCTTCCAAATAGCAAG
GAGACAAGTTGCCACGGATAG
Gene >OphauB2|4180
ATGAAACGTGACCCAAGGTCGACATTGCATCACGAGGTCGGCCGTGTGGCCTCCCAAACCACGCCCCTACTGAGA
AATGATGAATCTCGCGGCACGCCTGCGGGAAAGCCATTGCCCACATTCCAGATCCTTCTCCTATGCTATGCTCGG
CTGATGGAGCTTATTGCGCAGTATTCTGTGTACCCTTATATCGCGCAAATGATTCAGCGCAACCAGCATCTGCGC
CAATCCGACGTTGGGCTCTACAGCGGGCTCGTCGAGTCCATCTTCACCGTTGCCGAGACGGCAGTCTTGGCACTC
TGGTGCTACCTGGCGGACCACATTGGCCGCAAGTCGGCTCTCGTCTTCAGCCTCATCGGCATGGCAGTTGGACCC
GTGTTGTTTGGTGTAGCGAGTAGCATTGCCGAGATGATGTTATACCGATGTCTTGGCGGCGCTTTTTCCGGTGCG
GGACTTATTATTCGAACCATGATTGGCGACCATACAACCTCTGAGACGCAAGCTGTGGCCTACAGCTGGTTCGCC
ATGGCTGACAACCTGGGCGCCTTTGTGGGGCTGATAATCGGCGGTGCGCTTGCCGATCCTGTTACACAGTACCCC
AATGTCTTTGGCAATGTCAAGTTCTTCCAAGACTACCCATATGCCCTCCCTGGTATTGTCATTGGCATCATGAAC
TCAACGGCAGCTATTACTTCCACCATCTTTCTCCAAGAGACACTGGACAAGAAGACGGCCGAGACTCACAACCAT
GCATCTCCAGATCCACGTGCCGCAACACAGCCATGGGGTTTTCGGCAGCTAGCACATATACCGGGCCTATACGTA
GCCCTATCAGTATATGGTCAAGTCATGCTATTGAGGGCCTTGATAGCCGCTGTTCTTCCAGTTGCACTCTATACT
CCAGTGTTTCTGGGAGGTATAAACTGTACGCCGTCCCAGATATCGCTATACATGGGGAGCCAGGCCACCAGCCAG
TCGTTTTGGTTTCTACTTGCCTTTCCCTGGCTGCAGGCTCGCATGGGAACCAAGGCTGTCTTACGTCTATGTTCT
ATTGGCTACCCTCTGGTTTTCATGGGGTATATCCTTATGAATCTGTCTTTGCGTGAGGGAAGTCATGCATCTTTT
GCTTGGTTTTGGGTCTTCACGGCACTTACCGCATTTGTTGGACCAGCCGTCTTTATATCCCTCATTGCTGCACAG
CTCGTTATTAACGACCTCTCACCGGACCCGCACCTTCTTGGAAGCCTCAATGCTCTGGCCATGATGGTCCACAAC
GTTATCCAGATTGCAGCTCCTATTTTTGCAACTACAATGTACGCCGTTGGGGTTCGGGGTCAGGTAGCCTACGGG
TACCTTGGCTGGCTAGTTTGCATCCCGATACCTTTGGGCCTCTTTTTAGTCGTCAAGTGGCTTCCAAATAGCAAG
GAGACAAGTTGCCACGGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail