Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4172
Gene name
LocationContig_275:5002..6169
Strand+
Gene length (bp)1167
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 2.3E-16 23 81
PF04193 PQ-loop PQ loop repeat 3.8E-19 216 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 23 304 3.0E-48
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 38 307 1.0E-42
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 21 312 1.0E-34
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 23 305 4.0E-34
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 23 307 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 23 304 3.0E-48
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 38 307 1.0E-42
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 21 312 1.0E-34
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 23 305 4.0E-34
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 23 307 4.0E-24
sp|Q6ZP29|LAAT1_HUMAN Lysosomal amino acid transporter 1 homolog OS=Homo sapiens GN=PQLC2 PE=1 SV=1 27 313 4.0E-18
sp|Q5ZJX0|LAAT1_CHICK Lysosomal amino acid transporter 1 homolog OS=Gallus gallus GN=PQLC2 PE=2 SV=1 212 302 3.0E-17
sp|B0BMY1|LAAT1_RAT Lysosomal amino acid transporter 1 homolog OS=Rattus norvegicus GN=Pqlc2 PE=1 SV=1 212 312 7.0E-10
sp|Q8C4N4|LAAT1_MOUSE Lysosomal amino acid transporter 1 homolog OS=Mus musculus GN=Pqlc2 PE=2 SV=1 212 312 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 57 79 22
3 83 105 22
4 170 192 22
5 212 234 22
6 246 268 22
7 278 297 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4172
MASTTSMTTLVAAASGLPAGEILSGIFGSISMTAWICLLLPQLIANYRAKNAEALSVLFLIVWFLGDVSNFIGAL
LTSLAPSAIALAGYFCFLDVALIGQTLYYNSINSRPSADDSQVSEASPLIGNASVASASHRGPSTDDEPSTEPHA
KTLSGHVDTPAHVSWLRNCFNLLAIYVVGLVAWYVSYKAGLWNGSVPSIPDSPDGDYKRAGEIIGLCLGYISATF
YLCARVPQIVKNYKAKSCEGLSLLFFMLSTTGNLTYGLSLAAYSQERQYLLKAFPWLLGSLGTIVEDSIIFVQFR
LYANRARHPHSEP*
Coding >OphauB2|4172
ATGGCTTCTACAACTTCCATGACAACTTTGGTTGCAGCAGCCTCGGGGCTGCCTGCCGGAGAGATTCTTTCAGGC
ATATTTGGGAGCATTAGCATGACGGCTTGGATCTGCCTCTTGCTTCCCCAGCTCATTGCAAACTACAGAGCAAAG
AATGCCGAGGCCCTCAGCGTGTTGTTTCTCATTGTCTGGTTCCTTGGCGATGTCTCTAATTTCATCGGTGCCCTG
CTCACCAGTTTGGCTCCGAGTGCCATTGCCTTGGCGGGCTATTTTTGCTTTCTGGATGTCGCTCTCATCGGCCAG
ACCCTTTACTACAATTCCATAAATTCACGTCCGTCTGCCGACGATTCACAAGTGTCCGAGGCCTCACCGCTCATT
GGTAACGCCTCTGTCGCGTCCGCCTCGCATCGTGGCCCCAGTACAGACGATGAGCCATCGACAGAGCCGCATGCA
AAGACGCTTTCAGGGCACGTTGATACGCCTGCACATGTTTCATGGCTTCGCAATTGCTTCAACCTGCTGGCCATC
TATGTTGTGGGATTGGTGGCGTGGTACGTATCGTACAAGGCTGGACTTTGGAACGGCAGTGTTCCAAGCATTCCC
GATTCTCCAGACGGCGACTACAAGCGTGCGGGTGAAATTATCGGACTCTGTCTCGGCTATATCAGTGCAACGTTT
TATCTCTGTGCTCGAGTGCCTCAGATTGTCAAGAACTACAAGGCAAAGTCGTGCGAAGGTTTATCGCTTCTCTTC
TTCATGCTCTCTACAACGGGCAACCTGACGTATGGTTTGAGCCTTGCTGCGTACTCACAGGAGAGACAGTACCTA
CTAAAGGCCTTTCCTTGGCTTCTTGGGTCATTGGGCACTATAGTTGAGGACTCTATTATCTTTGTTCAGTTTCGC
CTATATGCCAACAGGGCCCGCCACCCTCACTCGGAGCCATGA
Transcript >OphauB2|4172
ATGGCTTCTACAACTTCCATGACAACTTTGGTTGCAGCAGCCTCGGGGCTGCCTGCCGGAGAGATTCTTTCAGGC
ATATTTGGGAGCATTAGCATGACGGCTTGGATCTGCCTCTTGCTTCCCCAGCTCATTGCAAACTACAGAGCAAAG
AATGCCGAGGCCCTCAGCGTGTTGTTTCTCATTGTCTGGTTCCTTGGCGATGTCTCTAATTTCATCGGTGCCCTG
CTCACCAGTTTGGCTCCGAGTGCCATTGCCTTGGCGGGCTATTTTTGCTTTCTGGATGTCGCTCTCATCGGCCAG
ACCCTTTACTACAATTCCATAAATTCACGTCCGTCTGCCGACGATTCACAAGTGTCCGAGGCCTCACCGCTCATT
GGTAACGCCTCTGTCGCGTCCGCCTCGCATCGTGGCCCCAGTACAGACGATGAGCCATCGACAGAGCCGCATGCA
AAGACGCTTTCAGGGCACGTTGATACGCCTGCACATGTTTCATGGCTTCGCAATTGCTTCAACCTGCTGGCCATC
TATGTTGTGGGATTGGTGGCGTGGTACGTATCGTACAAGGCTGGACTTTGGAACGGCAGTGTTCCAAGCATTCCC
GATTCTCCAGACGGCGACTACAAGCGTGCGGGTGAAATTATCGGACTCTGTCTCGGCTATATCAGTGCAACGTTT
TATCTCTGTGCTCGAGTGCCTCAGATTGTCAAGAACTACAAGGCAAAGTCGTGCGAAGGTTTATCGCTTCTCTTC
TTCATGCTCTCTACAACGGGCAACCTGACGTATGGTTTGAGCCTTGCTGCGTACTCACAGGAGAGACAGTACCTA
CTAAAGGCCTTTCCTTGGCTTCTTGGGTCATTGGGCACTATAGTTGAGGACTCTATTATCTTTGTTCAGTTTCGC
CTATATGCCAACAGGGCCCGCCACCCTCACTCGGAGCCATGA
Gene >OphauB2|4172
ATGGCTTCTACAACTTCCATGACAACTTTGGTTGCAGCAGCCTCGGGGCTGCCTGCCGGAGAGATTCTTTCAGGC
ATATTTGGGAGCATTAGCATGACGGCTTGGATCTGCCTCTTGGTACGAAACACGTAGTGCTCATGCTACTCATTT
GCTGACCCTGTCGCAGCTTCCCCAGCTCATTGCAAACTACAGAGCAAAGAATGCCGAGGCCCTCAGCGTGTTGTT
TCTCATTGTCTGGTTCCTTGGCGATGTCTCTAATTTCATCGGTTTGTTTTGCTATTGGTCTGCGACATGGCAAGC
CCTTGCAGCGAGGCTGACATTTCCGCATCAGGTGCCCTGCTCACCAGTTTGGCTCCGAGTGCCATTGCCTTGGCG
GGCTATTTTTGCTTTCTGGATGTCGCTCTCATCGGCCAGACCCTTTACTACAATTCCATAAATTCACGTCCGTCT
GCCGACGATTCACAAGTGTCCGAGGCCTCACCGCTCATTGGTAACGCCTCTGTCGCGTCCGCCTCGCATCGTGGC
CCCAGTACAGACGATGAGCCATCGACAGAGCCGCATGCAAAGACGCTTTCAGGGCACGTTGATACGCCTGCACAT
GTTTCATGGCTTCGCAATTGCTTCAACCTGCTGGCCATCTATGTTGTGGGATTGGTGGCGTGGTACGTATCGTAC
AAGGCTGGACTTTGGAACGGCAGTGTTCCAAGCATTCCCGATTCTCCAGACGGCGACTACAAGCGTGCGGGTGAA
ATTATCGGACTCTGTCTCGGCTATATCAGTGCAACGTTTTATCTCTGGTAGGCTGCCTCACAGGCCAAAAAACCA
GTCGATGACGCTAACTTGAGACGTAGTGCTCGAGTGCCTCAGATTGTCAAGAACTACAAGGCAAAGTCGTGCGAA
GGTAAAGCATGCATGGTTTTGCGGGCTGGTTTGATGAAATGTCTGACACGCACTCAAGGTTTATCGCTTCTCTTC
TTCATGCTCTCTACAACGGGCAACCTGACGTATGGTTTGAGCCTTGCTGCGTACTCACAGGAGAGACAGTACCTA
CTAAAGGCCTTTCCTTGGCTTCTTGGGTCATTGGGCACTATAGTTGAGGACTCTATTATCTTTGTTCAGTTTCGC
CTATATGCCAACAGGGCCCGCCACCCTCACTCGGAGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail