Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4168
Gene name
LocationContig_274:3057..7563
Strand-
Gene length (bp)4506
Transcript length (bp)4239
Coding sequence length (bp)4239
Protein length (aa) 1413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14633 SH2_2 SH2 domain 2.9E-85 1191 1400
PF14641 HTH_44 Helix-turn-helix DNA-binding domain of SPT6 3.6E-38 294 420
PF14639 YqgF Holliday-junction resolvase-like of SPT6 3.9E-32 710 865
PF14635 HHH_7 Helix-hairpin-helix motif 1.0E-31 867 976
PF14632 SPT6_acidic Acidic N-terminal SPT6 1.8E-23 42 132
PF17674 HHH_9 HHH domain 3.5E-05 985 1029
PF00017 SH2 SH2 domain 9.6E-05 1227 1303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NIV6|SPT6_NEUCR Transcription elongation factor spt-6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spt-6 PE=3 SV=1 1 1408 0.0E+00
sp|Q5B7Q7|SPT6_EMENI Transcription elongation factor spt6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spt6 PE=3 SV=2 4 1404 0.0E+00
sp|Q2U561|SPT6_ASPOR Transcription elongation factor spt6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spt6 PE=3 SV=1 4 1404 0.0E+00
sp|Q4WWH6|SPT6_ASPFU Transcription elongation factor spt6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt6 PE=3 SV=1 56 1404 0.0E+00
sp|Q09915|SPT6_SCHPO Transcription elongation factor spt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt6 PE=1 SV=2 42 1402 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NIV6|SPT6_NEUCR Transcription elongation factor spt-6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spt-6 PE=3 SV=1 1 1408 0.0E+00
sp|Q5B7Q7|SPT6_EMENI Transcription elongation factor spt6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spt6 PE=3 SV=2 4 1404 0.0E+00
sp|Q2U561|SPT6_ASPOR Transcription elongation factor spt6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spt6 PE=3 SV=1 4 1404 0.0E+00
sp|Q4WWH6|SPT6_ASPFU Transcription elongation factor spt6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt6 PE=3 SV=1 56 1404 0.0E+00
sp|Q09915|SPT6_SCHPO Transcription elongation factor spt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt6 PE=1 SV=2 42 1402 0.0E+00
sp|Q6BVE1|SPT6_DEBHA Transcription elongation factor SPT6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPT6 PE=3 SV=1 41 1412 0.0E+00
sp|Q3MNT0|SPT6_CANAL Transcription elongation factor SPT6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT6 PE=3 SV=1 57 1399 0.0E+00
sp|Q4PI89|SPT6_USTMA Transcription elongation factor SPT6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPT6 PE=3 SV=1 212 1407 0.0E+00
sp|Q6FLB1|SPT6_CANGA Transcription elongation factor SPT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPT6 PE=1 SV=1 56 1412 0.0E+00
sp|Q75EP8|SPT6_ASHGO Transcription elongation factor SPT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT6 PE=3 SV=2 56 1399 0.0E+00
sp|P23615|SPT6_YEAST Transcription elongation factor SPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT6 PE=1 SV=1 16 1408 0.0E+00
sp|P0CR73|SPT6_CRYNB Transcription elongation factor SPT6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT6 PE=3 SV=1 185 1412 0.0E+00
sp|P0CR72|SPT6_CRYNJ Transcription elongation factor SPT6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT6 PE=3 SV=1 185 1412 0.0E+00
sp|Q4HYQ4|SPT6_GIBZE Transcription elongation factor SPT6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT6 PE=3 SV=1 1 1412 0.0E+00
sp|Q6CVK3|SPT6_KLULA Transcription elongation factor SPT6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPT6 PE=3 SV=1 119 1399 4.0E-180
sp|Q7KZ85|SPT6H_HUMAN Transcription elongation factor SPT6 OS=Homo sapiens GN=SUPT6H PE=1 SV=2 256 1404 2.0E-124
sp|Q62383|SPT6H_MOUSE Transcription elongation factor SPT6 OS=Mus musculus GN=Supt6h PE=1 SV=2 256 1404 5.0E-123
sp|Q8UVK2|SPT6H_DANRE Transcription elongation factor SPT6 OS=Danio rerio GN=supt6h PE=1 SV=1 212 1404 7.0E-115
sp|Q9W420|SPT6H_DROME Transcription elongation factor SPT6 OS=Drosophila melanogaster GN=Spt6 PE=1 SV=1 256 1399 2.0E-108
sp|Q93148|SPT6H_CAEBR Suppressor of Ty 6 homolog OS=Caenorhabditis briggsae GN=emb-5 PE=2 SV=2 254 1405 3.0E-101
sp|P34703|SPT6H_CAEEL Suppressor of Ty 6 homolog OS=Caenorhabditis elegans GN=emb-5 PE=1 SV=1 254 1403 5.0E-99
sp|P71353|Y568_HAEIN Uncharacterized protein HI_0568 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0568 PE=3 SV=1 607 1174 6.0E-19
sp|Q51152|YHGF_NEIMB Uncharacterized protein NMB0075 OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB0075 PE=3 SV=2 721 1174 8.0E-17
sp|P57072|YHGF_NEIMA Uncharacterized protein NMA0194 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=NMA0194 PE=3 SV=1 721 1174 1.0E-16
sp|Q45388|TEX_BORPE Protein tex OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tex PE=3 SV=2 677 1172 2.0E-16
sp|P46837|YHGF_ECOLI Protein YhgF OS=Escherichia coli (strain K12) GN=yhgF PE=1 SV=3 818 1174 3.0E-15
sp|Q8N5C6|SRBD1_HUMAN S1 RNA-binding domain-containing protein 1 OS=Homo sapiens GN=SRBD1 PE=1 SV=2 815 1112 6.0E-14
sp|Q5RDI0|SRBD1_PONAB S1 RNA-binding domain-containing protein 1 OS=Pongo abelii GN=SRBD1 PE=2 SV=1 815 1112 6.0E-14
sp|O31489|YDCI_BACSU Uncharacterized protein YdcI OS=Bacillus subtilis (strain 168) GN=ydcI PE=3 SV=2 531 998 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4168
MSNSMRDLISGEAELDDDEDDASFDEETGEERRRKTVTQFEDSSEEEEDDDDEEEARKIREGFIVDEDEEEEDEA
GESDAEQRLAKRKREHRDREEEEQLDEEDLELIGEQFGERPKSQTQSKFKRLKRGHRGEDEPLQHSRGLDEIFSD
EDEDTGDQRPFGRPNFRAQADEFDDFIEEDFPEDEDERIRQLEDAEVARPRDRGVGNVVDTSGLDKDALDDMEAI
FGNGEDYDWALQLEDEEEDRDRDEQAIELKDVFEPSQLKEKLLTDEDNEIRFSDEPERFQIDRKPFKNLQLTADQ
FREEARWITNQLWPKKGLAQELQAPFGKAVSKVLEFFIVDEVEVPFVFQHRKDYLLHSKKIRRSTRDDPDGPDYT
IQSDKLLNQDDLWRILELDIKFRSFVDKRNALEKTVENLRTLGVDDDLVEDMIPDATTMEELQDLQDYLHFQYGP
QIRELAASAGTASHMKRPGSKSSLLDRIRNGKAYKFVRAYGISADQLAKNALRYGKKIAPDDDEQYPLDLADSLI
DDNFNTGDQVINAARQMFSEELYANPRMRKYFRSSFYQAAEISCRRTDKGLRKIDDLHPYYEVKYLQNQAIADLV
HQPEVFLKMMRAEEESLVEIKVEMPPRYDFRRQLYQEFESENFSDRAEQWREERKRVLDLAYPKLEKIIVKNVKE
VIRTFCQDEVLKMCRQELYRKLDQAPYKPKGMVLGTTPRVLALSNGMGDSNREPICWAWVEEDGRVLEQGKLVNL
ARDEAQRDELAELVQRRRPDVIGVSGWCADTHKLVRDLESIVSEKGLMGPEFDDPETNDYRTEALEVVVVDDEVA
RLYKDSPRALAEHPSLNPVTRYCVALARYMQNPLKEYAALGKDIGSLSFHPCQHLLPQDKLMRYLESAMVDTVNM
VGVNINDAMTDGYTANLLPYVAGLGPRKATSVIKAINANGGSVNTRADLVGDPDSGKLPVVSPRVWNNCASFLYI
DYDATNPSSDPLDNTRVHPEDYELGRKMAADALELDEEDVKAETDENGPGAIVRKLFKQDEQERVNELVLDEYAD
QLLKKFNQRKRATLEAISAELQAPYEELRRSFSLLNQSEIFTIFTGETKTTLCEGMIVPVNVRMVRDDFAIVRLD
CGIEGRAEAHEVTSRSSVKDVLSSGQTVQARIMEMNYKDLMAKVSMREDSLRIPYKRPINYGRDGWDYDLEAKDR
DDMRVKDRITGRTQRVVKHPNFKPYNSVQAEEYLGSQPAGEVIVRPSSKGNDHLAVTWKVADGVYQHIDVLEMQK
ENEFSVGKLLRVGGKYTYSDLDELIVDHVKAMARKVEELMRHDKFQKRSQGETEKWLTTYVDANPNRSAYAFCID
TKHPGYFWLCFKASRTARVIGLPVRAIPQGYELRGYQYPDMRALCNGFKLRYQNEFSKMGNR*
Coding >OphauB2|4168
ATGAGCAACTCGATGCGCGACCTCATTTCGGGGGAGGCTGAGCTCGATGACGACGAAGACGACGCGTCTTTTGAC
GAAGAGACTGGAGAGGAACGACGGCGCAAAACTGTCACACAGTTTGAAGACTCTAGCGAAGAAGAAGAGGACGAC
GACGATGAGGAGGAGGCGCGCAAGATTCGCGAAGGTTTCATTGTAGATGAAGATGAGGAAGAGGAAGACGAGGCC
GGAGAGTCCGACGCTGAGCAACGCTTGGCAAAAAGAAAGCGCGAGCATCGCGACCGCGAGGAAGAAGAGCAACTG
GATGAAGAGGACCTGGAACTAATAGGCGAACAATTTGGTGAAAGGCCCAAATCTCAGACTCAGTCTAAATTCAAG
CGGCTCAAACGCGGCCATCGCGGTGAAGATGAGCCTCTACAGCATTCTCGTGGGCTCGATGAAATTTTTTCCGAC
GAAGATGAGGACACTGGGGACCAACGGCCGTTTGGTCGCCCCAACTTTCGCGCCCAAGCCGATGAATTTGACGAT
TTTATCGAAGAAGATTTTCCAGAAGACGAGGATGAACGGATTCGTCAGCTCGAAGATGCCGAAGTTGCCCGCCCG
CGAGATCGAGGTGTCGGAAACGTTGTCGATACTAGCGGTCTCGACAAGGACGCACTCGACGATATGGAGGCCATT
TTTGGCAACGGTGAAGACTACGACTGGGCTCTCCAGCTAGAGGACGAAGAAGAAGATCGCGACCGAGATGAACAG
GCTATAGAGCTCAAGGATGTCTTTGAGCCCTCGCAGCTAAAGGAAAAGCTTCTCACTGATGAGGACAATGAGATT
CGCTTTAGCGATGAGCCAGAACGATTCCAAATCGACCGCAAGCCGTTTAAGAATTTGCAGCTTACAGCGGATCAG
TTTAGGGAGGAAGCGCGATGGATCACGAACCAGCTGTGGCCAAAAAAGGGTCTTGCGCAGGAGCTGCAGGCACCT
TTTGGCAAGGCTGTTAGCAAAGTGCTCGAGTTCTTCATCGTTGACGAGGTTGAAGTGCCGTTTGTCTTTCAGCAT
CGCAAAGACTACCTGCTTCACTCCAAAAAGATTCGCAGATCAACACGCGACGATCCCGATGGCCCCGACTACACT
ATTCAATCTGACAAACTACTAAATCAGGACGACCTTTGGCGGATTCTCGAGCTGGACATCAAGTTTCGTTCCTTT
GTCGATAAAAGGAATGCTTTGGAAAAGACGGTTGAGAATCTCCGGACTCTAGGGGTGGATGACGACTTGGTCGAA
GACATGATTCCAGACGCGACGACAATGGAAGAGCTGCAGGATCTCCAAGACTATCTGCACTTTCAGTACGGTCCA
CAGATACGAGAGCTGGCAGCCTCGGCGGGCACCGCGTCGCACATGAAGCGGCCTGGCTCCAAATCGTCGTTGCTG
GATCGCATTCGCAATGGCAAAGCATACAAATTTGTCAGGGCCTATGGCATTTCTGCTGATCAGCTAGCCAAGAAT
GCTTTGCGATATGGCAAAAAGATTGCACCTGATGACGACGAGCAATACCCCCTGGATCTGGCAGACAGTCTGATT
GATGACAACTTCAACACGGGCGATCAAGTCATCAATGCTGCGCGCCAAATGTTCTCGGAAGAGCTCTATGCCAAT
CCGCGAATGCGCAAGTACTTTCGGAGCTCCTTTTATCAGGCCGCAGAAATAAGCTGTAGGCGGACTGACAAGGGC
CTGCGCAAGATTGATGATTTACACCCATACTACGAAGTCAAGTATCTACAGAACCAGGCTATTGCCGATCTCGTG
CACCAGCCTGAAGTTTTCCTCAAGATGATGCGCGCCGAAGAAGAGAGCTTGGTTGAAATCAAGGTGGAAATGCCG
CCGAGATATGACTTTAGACGCCAACTGTACCAGGAATTCGAGTCTGAAAACTTTAGTGATCGTGCTGAACAGTGG
AGGGAGGAACGGAAACGCGTGCTTGATCTCGCTTACCCAAAGCTCGAAAAGATCATTGTCAAGAATGTCAAGGAG
GTTATTCGCACCTTTTGCCAGGACGAAGTCCTCAAGATGTGTCGGCAAGAGCTATACAGGAAGCTGGATCAAGCT
CCCTACAAGCCAAAGGGAATGGTGCTGGGAACAACTCCGCGTGTTTTGGCTCTATCCAACGGCATGGGAGATTCC
AATCGTGAGCCCATTTGCTGGGCCTGGGTGGAGGAAGATGGCCGAGTTCTCGAACAAGGCAAGCTGGTCAACCTT
GCTCGCGACGAGGCGCAGCGTGACGAGCTTGCGGAGCTTGTTCAGCGCCGCCGGCCCGACGTTATTGGCGTGAGC
GGTTGGTGTGCCGATACACACAAGTTGGTTCGCGACCTGGAGAGCATTGTGAGCGAAAAGGGCTTAATGGGCCCC
GAATTTGACGATCCCGAGACGAATGACTATCGCACCGAAGCGCTCGAGGTTGTGGTGGTGGACGATGAGGTGGCG
CGGCTCTACAAGGACAGCCCCCGTGCACTGGCCGAACACCCGTCGCTGAACCCCGTGACTCGATACTGTGTGGCA
TTGGCACGCTACATGCAGAATCCGCTCAAGGAGTATGCAGCGCTGGGCAAGGACATTGGATCGCTCTCCTTTCAC
CCCTGCCAGCACTTGTTGCCCCAGGACAAGCTGATGAGGTATCTCGAGTCAGCCATGGTGGACACGGTCAACATG
GTGGGAGTCAATATCAATGACGCCATGACTGATGGCTATACGGCCAATCTGCTGCCCTATGTTGCTGGTCTTGGT
CCTCGAAAGGCGACGAGTGTCATCAAGGCCATCAATGCCAATGGCGGCTCCGTCAATACTCGTGCTGACCTTGTT
GGAGACCCTGACAGCGGCAAGCTTCCAGTGGTGAGCCCGCGCGTGTGGAACAATTGCGCCAGCTTTTTGTACATT
GACTATGATGCGACGAATCCGTCGTCTGATCCTCTGGACAATACGCGTGTGCACCCAGAAGACTATGAGCTTGGT
CGCAAAATGGCGGCCGACGCACTGGAGCTGGATGAAGAAGACGTCAAGGCTGAGACGGACGAAAATGGCCCGGGC
GCCATTGTGCGCAAGCTGTTTAAGCAAGACGAACAAGAGCGCGTCAATGAGCTGGTGCTGGACGAGTATGCTGAT
CAGCTGCTCAAAAAGTTTAACCAGCGCAAGCGGGCAACGCTTGAGGCGATTAGTGCTGAGCTCCAGGCGCCCTAT
GAAGAGCTCCGGCGCAGCTTTTCCCTGCTCAACCAGTCGGAGATTTTTACCATTTTCACGGGCGAGACCAAGACG
ACGCTCTGCGAGGGCATGATTGTGCCGGTCAATGTGCGCATGGTGCGAGACGACTTTGCCATTGTCAGGCTCGAC
TGTGGAATAGAGGGTCGGGCCGAGGCGCACGAAGTGACGAGCCGGTCATCGGTCAAGGATGTGCTGAGTTCTGGA
CAAACGGTGCAGGCGCGCATCATGGAGATGAACTACAAGGACTTGATGGCCAAGGTGTCGATGCGGGAGGATTCG
TTGCGGATCCCGTACAAGCGGCCCATCAACTATGGGCGTGACGGATGGGACTATGATTTGGAGGCCAAGGACCGG
GACGACATGCGCGTAAAGGACCGAATCACGGGACGGACGCAGCGCGTGGTGAAGCATCCCAACTTCAAGCCGTAC
AATTCCGTGCAGGCCGAGGAGTACCTTGGGTCGCAGCCGGCGGGCGAGGTGATTGTGCGGCCGTCATCCAAGGGC
AACGACCATTTGGCGGTGACGTGGAAAGTGGCGGACGGCGTCTACCAGCACATTGACGTGCTCGAGATGCAAAAG
GAAAACGAGTTTTCAGTGGGCAAGCTGCTGCGTGTTGGGGGCAAGTACACGTATAGCGACTTGGACGAGCTGATT
GTCGACCACGTCAAGGCCATGGCGCGCAAAGTGGAGGAGCTGATGCGTCATGACAAGTTTCAAAAGCGGTCTCAG
GGCGAAACAGAAAAATGGCTGACGACATATGTTGATGCCAACCCGAATCGGTCTGCATATGCATTTTGCATCGAC
ACCAAGCACCCTGGCTATTTCTGGCTCTGCTTCAAGGCGAGTCGGACGGCAAGAGTCATTGGGCTGCCGGTGCGA
GCAATTCCACAGGGCTATGAATTACGGGGATACCAGTACCCAGACATGCGTGCCTTGTGCAACGGCTTCAAGCTG
CGTTACCAAAACGAATTTTCCAAGATGGGGAACCGGTAA
Transcript >OphauB2|4168
ATGAGCAACTCGATGCGCGACCTCATTTCGGGGGAGGCTGAGCTCGATGACGACGAAGACGACGCGTCTTTTGAC
GAAGAGACTGGAGAGGAACGACGGCGCAAAACTGTCACACAGTTTGAAGACTCTAGCGAAGAAGAAGAGGACGAC
GACGATGAGGAGGAGGCGCGCAAGATTCGCGAAGGTTTCATTGTAGATGAAGATGAGGAAGAGGAAGACGAGGCC
GGAGAGTCCGACGCTGAGCAACGCTTGGCAAAAAGAAAGCGCGAGCATCGCGACCGCGAGGAAGAAGAGCAACTG
GATGAAGAGGACCTGGAACTAATAGGCGAACAATTTGGTGAAAGGCCCAAATCTCAGACTCAGTCTAAATTCAAG
CGGCTCAAACGCGGCCATCGCGGTGAAGATGAGCCTCTACAGCATTCTCGTGGGCTCGATGAAATTTTTTCCGAC
GAAGATGAGGACACTGGGGACCAACGGCCGTTTGGTCGCCCCAACTTTCGCGCCCAAGCCGATGAATTTGACGAT
TTTATCGAAGAAGATTTTCCAGAAGACGAGGATGAACGGATTCGTCAGCTCGAAGATGCCGAAGTTGCCCGCCCG
CGAGATCGAGGTGTCGGAAACGTTGTCGATACTAGCGGTCTCGACAAGGACGCACTCGACGATATGGAGGCCATT
TTTGGCAACGGTGAAGACTACGACTGGGCTCTCCAGCTAGAGGACGAAGAAGAAGATCGCGACCGAGATGAACAG
GCTATAGAGCTCAAGGATGTCTTTGAGCCCTCGCAGCTAAAGGAAAAGCTTCTCACTGATGAGGACAATGAGATT
CGCTTTAGCGATGAGCCAGAACGATTCCAAATCGACCGCAAGCCGTTTAAGAATTTGCAGCTTACAGCGGATCAG
TTTAGGGAGGAAGCGCGATGGATCACGAACCAGCTGTGGCCAAAAAAGGGTCTTGCGCAGGAGCTGCAGGCACCT
TTTGGCAAGGCTGTTAGCAAAGTGCTCGAGTTCTTCATCGTTGACGAGGTTGAAGTGCCGTTTGTCTTTCAGCAT
CGCAAAGACTACCTGCTTCACTCCAAAAAGATTCGCAGATCAACACGCGACGATCCCGATGGCCCCGACTACACT
ATTCAATCTGACAAACTACTAAATCAGGACGACCTTTGGCGGATTCTCGAGCTGGACATCAAGTTTCGTTCCTTT
GTCGATAAAAGGAATGCTTTGGAAAAGACGGTTGAGAATCTCCGGACTCTAGGGGTGGATGACGACTTGGTCGAA
GACATGATTCCAGACGCGACGACAATGGAAGAGCTGCAGGATCTCCAAGACTATCTGCACTTTCAGTACGGTCCA
CAGATACGAGAGCTGGCAGCCTCGGCGGGCACCGCGTCGCACATGAAGCGGCCTGGCTCCAAATCGTCGTTGCTG
GATCGCATTCGCAATGGCAAAGCATACAAATTTGTCAGGGCCTATGGCATTTCTGCTGATCAGCTAGCCAAGAAT
GCTTTGCGATATGGCAAAAAGATTGCACCTGATGACGACGAGCAATACCCCCTGGATCTGGCAGACAGTCTGATT
GATGACAACTTCAACACGGGCGATCAAGTCATCAATGCTGCGCGCCAAATGTTCTCGGAAGAGCTCTATGCCAAT
CCGCGAATGCGCAAGTACTTTCGGAGCTCCTTTTATCAGGCCGCAGAAATAAGCTGTAGGCGGACTGACAAGGGC
CTGCGCAAGATTGATGATTTACACCCATACTACGAAGTCAAGTATCTACAGAACCAGGCTATTGCCGATCTCGTG
CACCAGCCTGAAGTTTTCCTCAAGATGATGCGCGCCGAAGAAGAGAGCTTGGTTGAAATCAAGGTGGAAATGCCG
CCGAGATATGACTTTAGACGCCAACTGTACCAGGAATTCGAGTCTGAAAACTTTAGTGATCGTGCTGAACAGTGG
AGGGAGGAACGGAAACGCGTGCTTGATCTCGCTTACCCAAAGCTCGAAAAGATCATTGTCAAGAATGTCAAGGAG
GTTATTCGCACCTTTTGCCAGGACGAAGTCCTCAAGATGTGTCGGCAAGAGCTATACAGGAAGCTGGATCAAGCT
CCCTACAAGCCAAAGGGAATGGTGCTGGGAACAACTCCGCGTGTTTTGGCTCTATCCAACGGCATGGGAGATTCC
AATCGTGAGCCCATTTGCTGGGCCTGGGTGGAGGAAGATGGCCGAGTTCTCGAACAAGGCAAGCTGGTCAACCTT
GCTCGCGACGAGGCGCAGCGTGACGAGCTTGCGGAGCTTGTTCAGCGCCGCCGGCCCGACGTTATTGGCGTGAGC
GGTTGGTGTGCCGATACACACAAGTTGGTTCGCGACCTGGAGAGCATTGTGAGCGAAAAGGGCTTAATGGGCCCC
GAATTTGACGATCCCGAGACGAATGACTATCGCACCGAAGCGCTCGAGGTTGTGGTGGTGGACGATGAGGTGGCG
CGGCTCTACAAGGACAGCCCCCGTGCACTGGCCGAACACCCGTCGCTGAACCCCGTGACTCGATACTGTGTGGCA
TTGGCACGCTACATGCAGAATCCGCTCAAGGAGTATGCAGCGCTGGGCAAGGACATTGGATCGCTCTCCTTTCAC
CCCTGCCAGCACTTGTTGCCCCAGGACAAGCTGATGAGGTATCTCGAGTCAGCCATGGTGGACACGGTCAACATG
GTGGGAGTCAATATCAATGACGCCATGACTGATGGCTATACGGCCAATCTGCTGCCCTATGTTGCTGGTCTTGGT
CCTCGAAAGGCGACGAGTGTCATCAAGGCCATCAATGCCAATGGCGGCTCCGTCAATACTCGTGCTGACCTTGTT
GGAGACCCTGACAGCGGCAAGCTTCCAGTGGTGAGCCCGCGCGTGTGGAACAATTGCGCCAGCTTTTTGTACATT
GACTATGATGCGACGAATCCGTCGTCTGATCCTCTGGACAATACGCGTGTGCACCCAGAAGACTATGAGCTTGGT
CGCAAAATGGCGGCCGACGCACTGGAGCTGGATGAAGAAGACGTCAAGGCTGAGACGGACGAAAATGGCCCGGGC
GCCATTGTGCGCAAGCTGTTTAAGCAAGACGAACAAGAGCGCGTCAATGAGCTGGTGCTGGACGAGTATGCTGAT
CAGCTGCTCAAAAAGTTTAACCAGCGCAAGCGGGCAACGCTTGAGGCGATTAGTGCTGAGCTCCAGGCGCCCTAT
GAAGAGCTCCGGCGCAGCTTTTCCCTGCTCAACCAGTCGGAGATTTTTACCATTTTCACGGGCGAGACCAAGACG
ACGCTCTGCGAGGGCATGATTGTGCCGGTCAATGTGCGCATGGTGCGAGACGACTTTGCCATTGTCAGGCTCGAC
TGTGGAATAGAGGGTCGGGCCGAGGCGCACGAAGTGACGAGCCGGTCATCGGTCAAGGATGTGCTGAGTTCTGGA
CAAACGGTGCAGGCGCGCATCATGGAGATGAACTACAAGGACTTGATGGCCAAGGTGTCGATGCGGGAGGATTCG
TTGCGGATCCCGTACAAGCGGCCCATCAACTATGGGCGTGACGGATGGGACTATGATTTGGAGGCCAAGGACCGG
GACGACATGCGCGTAAAGGACCGAATCACGGGACGGACGCAGCGCGTGGTGAAGCATCCCAACTTCAAGCCGTAC
AATTCCGTGCAGGCCGAGGAGTACCTTGGGTCGCAGCCGGCGGGCGAGGTGATTGTGCGGCCGTCATCCAAGGGC
AACGACCATTTGGCGGTGACGTGGAAAGTGGCGGACGGCGTCTACCAGCACATTGACGTGCTCGAGATGCAAAAG
GAAAACGAGTTTTCAGTGGGCAAGCTGCTGCGTGTTGGGGGCAAGTACACGTATAGCGACTTGGACGAGCTGATT
GTCGACCACGTCAAGGCCATGGCGCGCAAAGTGGAGGAGCTGATGCGTCATGACAAGTTTCAAAAGCGGTCTCAG
GGCGAAACAGAAAAATGGCTGACGACATATGTTGATGCCAACCCGAATCGGTCTGCATATGCATTTTGCATCGAC
ACCAAGCACCCTGGCTATTTCTGGCTCTGCTTCAAGGCGAGTCGGACGGCAAGAGTCATTGGGCTGCCGGTGCGA
GCAATTCCACAGGGCTATGAATTACGGGGATACCAGTACCCAGACATGCGTGCCTTGTGCAACGGCTTCAAGCTG
CGTTACCAAAACGAATTTTCCAAGATGGGGAACCGGTAA
Gene >OphauB2|4168
ATGAGCAACTCGATGCGCGACCTCATTTCGGGGGAGGCTGAGCTCGATGACGACGAAGACGACGCGTCTTTTGAC
GAAGAGACTGGAGAGGAACGACGGCGCAAAACTGTCACACAGTTTGAAGACTCTAGCGAAGAAGAAGAGGACGAC
GACGATGAGGAGGAGGCGCGCAAGGTACGTTTATGTGGCAGCGTGCCCCCTGGCCGAAAATAATGGACTAATTTC
GCGTCGACGCGGCAGATTCGCGAAGGTTTCATTGTAGATGAAGATGAGGAAGAGGAAGACGAGGCCGGAGAGTCC
GACGCTGAGCAACGCTTGGCAAAAAGAAAGCGCGAGCATCGCGACCGCGAGGAAGAAGAGCAACTGGATGAAGAG
GACCTGGAACTAATAGGCGAACAATTTGGTGAAAGGCCCAAATCTCAGACTCAGGTTGGTCTCATCTCTAGCCTA
TCTCTGGTGCTCATGATTCATTGACGAGTCGTCTCCCAGTCTAAATTCAAGCGGCTCAAACGCGGCCATCGCGGT
GAAGATGAGCCTCTACAGCATTCTCGTGGGCTCGATGAAATTTTTTCCGACGAAGATGAGGACACTGGGGACCAA
CGGCCGTTTGGTCGCCCCAACTTTCGCGCCCAAGCCGATGAATTTGACGATTTTATCGAAGAAGATTTTCCAGAA
GACGAGGATGAACGGATTCGTCAGCTCGAAGATGCCGAAGTTGCCCGCCCGCGAGATCGAGGTGTCGGAAACGTT
GTCGATACTAGCGGTCTCGACAAGGACGCACTCGACGATATGGAGGCCATTTTTGGCAACGGTGAAGACTACGAC
TGGGCTCTCCAGCTAGAGGACGAAGAAGAAGATCGCGACCGAGATGAACAGGCTATAGAGCTCAAGGATGTCTTT
GAGCCCTCGCAGCTAAAGGAAAAGCTTCTCACTGATGAGGACAATGAGATTCGCTTTAGCGATGAGCCAGAACGA
TTCCAAATCGACCGCAAGCCGTTTAAGAATTTGCAGCTTACAGCGGATCAGTTTAGGGAGGAAGCGCGATGGATC
ACGAACCAGCTGTGGCCAAAAAAGGGTCTTGCGCAGGAGCTGCAGGCACCTTTTGGCAAGGCTGTTAGCAAAGTG
CTCGAGTTCTTCATCGTTGACGAGGTTGAAGTGCCGTTTGTCTTTCAGCATCGCAAAGACTACCTGCTTCACTCC
AAAAAGATTCGCAGATCAACACGCGACGATCCCGATGGCCCCGACTACACTATTCAATCTGACAAACTACTAAAT
CAGGACGACCTTTGGCGGATTCTCGAGCTGGACATCAAGTTTCGTTCCTTTGTCGATAAAAGGAATGCTTTGGAA
AAGACGGTTGAGAATCTCCGGACTCTAGGGGTGGATGACGACTTGGTCGAAGACATGATTCCAGACGCGACGACA
ATGGAAGAGCTGCAGGATCTCCAAGACTATCTGCACTTTCAGTACGGTCCACAGATACGAGAGCTGGCAGCCTCG
GCGGGCACCGCGTCGCACATGAAGCGGCCTGGCTCCAAATCGTCGTTGCTGGATCGCATTCGCAATGGCAAAGCA
TACAAATTTGTCAGGGCCTATGGCATTTCTGCTGATCAGCTAGCCAAGAATGCTTTGCGATATGGCAAAAAGATT
GCACCTGATGACGACGAGCAATACCCCCTGGATCTGGCAGACAGTCTGATTGATGACAACTTCAACACGGGCGAT
CAAGTCATCAATGCTGCGCGCCAAATGTTCTCGGAAGAGCTCTATGCCAATCCGCGAATGCGCAAGTACTTTCGG
AGCTCCTTTTATCAGGCCGCAGAAATAAGCTGTAGGCGGACTGACAAGGGCCTGCGCAAGATTGATGATTTACAC
CCATACTACGAAGTCAAGTATCTACAGAACCAGGCTATTGCCGATCTCGTGCACCAGCCTGAAGTTTTCCTCAAG
ATGATGCGCGCCGAAGAAGAGAGCTTGGTTGAAATCAAGGTGGAAATGCCGCCGAGATATGACTTTAGACGCCAA
CTGTACCAGGAATTCGAGTCTGAAAACTTTAGTGATCGTGCTGAACAGTGGAGGGAGGAACGGAAACGCGTGCTT
GATCTCGCTTACCCAAAGCTCGAAAAGATCATTGTCAAGAATGTCAAGGAGGTTATTCGCACCTTTTGCCAGGAC
GAAGTCCTCAAGATGTGTCGGCAAGAGCTATACAGGAAGCTGGATCAAGCTCCCTACAAGCCAAAGGGAATGGTG
CTGGGAACAACTCCGCGTGTTTTGGCTCTATCCAACGGCATGGGAGATTCCAATCGTGAGCCCATTTGCTGGGCC
TGGGTGGAGGAAGATGGCCGAGTTCTCGAACAAGGCAAGCTGGTCAACCTTGCTCGCGACGAGGCGCAGCGTGAC
GAGCTTGCGGAGCTTGTTCAGCGCCGCCGGCCCGACGTTATTGGCGTGAGCGGTTGGTGTGCCGATACACACAAG
TTGGTTCGCGACCTGGAGAGCATTGTGAGCGAAAAGGGCTTAATGGGCCCCGAATTTGACGATCCCGAGACGAAT
GACTATCGCACCGAAGCGCTCGAGGTTGTGGTGGTGGACGATGAGGTGGCGCGGCTCTACAAGGACAGCCCCCGT
GCACTGGCCGAACACCCGTCGCTGAACCCCGTGACTCGATACTGTGTGGCATTGGCACGCTACATGCAGAATCCG
CTCAAGGAGTATGCAGCGCTGGGCAAGGACATTGGATCGCTCTCCTTTCACCCCTGCCAGCACTTGTTGCCCCAG
GACAAGCTGATGAGGTATCTCGAGTCAGCCATGGTGGACACGGTCAACATGGTGGGAGTCAATATCAATGACGCC
ATGACTGATGGCTATACGGCCAATCTGCTGCCCTATGTTGCTGGTCTTGGTCCTCGAAAGGCGACGAGTGTCATC
AAGGCCATCAATGCCAATGGCGGCTCCGTCAATACTCGTGCTGACCTTGTTGGAGACCCTGACAGCGGCAAGCTT
CCAGTGGTGAGCCCGCGCGTGTGGAACAATTGCGCCAGCTTTTTGTACATTGACTATGATGCGACGAATCCGTCG
TCTGATCCTCTGGACAATACGCGTGTGCACCCAGAAGACTATGAGCTTGGTCGCAAAATGGCGGCCGACGCACTG
GAGCTGGATGAAGAAGACGTCAAGGCTGAGACGGACGAAAATGGCCCGGGCGCCATTGTGCGCAAGCTGTTTAAG
CAAGACGAACAAGAGCGCGTCAATGAGCTGGTGCTGGACGAGTATGCTGATCAGCTGCTCAAAAAGTTTAACCAG
CGCAAGCGGGCAACGCTTGAGGCGATTAGTGCTGAGCTCCAGGCGCCCTATGAAGAGCTCCGGCGCAGCTTTTCC
CTGCTCAACCAGTCGGAGATTTTTACCATTTTCACGGGCGAGACCAAGACGACGCTCTGCGAGGGCATGATTGTG
CCGGTCAATGTGCGCATGGTGCGAGACGACTTTGCCATTGTCAGGCTCGACTGTGGAATAGAGGGTCGGGCCGAG
GCGCACGAAGTGACGAGCCGGTCATCGGTCAAGGATGTGCTGAGTTCTGGACAAACGGTGCAGGCGCGCATCATG
GAGATGAACTACAAGGACTTGATGGCCAAGGTGTCGATGCGGGAGGATTCGTTGCGGATCCCGTACAAGCGGCCC
ATCAACTATGGGCGTGACGGATGGGACTATGATTTGGAGGCCAAGGACCGGGACGACATGCGCGTAAAGGACCGA
ATCACGGGACGGACGCAGCGCGTGGTGAAGCATCCCAACTTCAAGCCGTACAATTCCGTGCAGGCCGAGGAGTAC
CTTGGGTCGCAGCCGGCGGGCGAGGTGATTGTGCGGCCGTCATCCAAGGGCAACGACCATTTGGCGGTGACGTGG
AAAGTGGCGGACGGCGTCTACCAGCACATTGACGTGCTCGAGATGCAAAAGGAAAACGAGTTTTCAGTGGGCAAG
CTGCTGCGTGTTGGGGGCAAGTACACGTATAGCGACTTGGACGAGCTGATTGTCGACCACGTCAAGGCCATGGCG
CGCAAAGTGGAGGAGCTGATGCGTCATGACAAGTTTCAAAAGCGGTCTCAGGGCGAAACAGGTGTGTTTGTGTGT
TTGTTTGTTTGTGTGTGTATTGTGTGTTGTGTGTGTTGTGTGTGTGTGTGTGTGTGTGTCGTGCAATGGAGAGCG
TCTACTTTTATTGTTGTGCTTGCAAAGGACGGCAGCTAACGGCGTCTTGCAGAAAAATGGCTGACGACATATGTT
GATGCCAACCCGAATCGGTCTGCATATGCATTTTGCATCGACACCAAGCACCCTGGCTATTTCTGGCTCTGCTTC
AAGGCGAGTCGGACGGCAAGAGTCATTGGGCTGCCGGTGCGAGCAATTCCACAGGGCTATGAATTACGGGGATAC
CAGTACCCAGACATGCGTGCCTTGTGCAACGGCTTCAAGCTGCGTTACCAAAACGAATTTTCCAAGATGGGGAAC
CGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail