Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4165
Gene name
LocationContig_273:5818..9534
Strand-
Gene length (bp)3716
Transcript length (bp)3345
Coding sequence length (bp)3345
Protein length (aa) 1115

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11882 DUF3402 Domain of unknown function (DUF3402) 5.5E-197 564 1086
PF07923 N1221 N1221-like protein 1.4E-89 163 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8C9H6|STRP2_MOUSE Striatin-interacting proteins 2 OS=Mus musculus GN=Strip2 PE=1 SV=1 921 1062 9.0E-25
sp|Q9ULQ0|STRP2_HUMAN Striatin-interacting protein 2 OS=Homo sapiens GN=STRIP2 PE=1 SV=2 921 1062 1.0E-24
sp|Q9GLZ5|STRP1_MACFA Striatin-interacting protein 1 OS=Macaca fascicularis GN=STRIP1 PE=2 SV=1 939 1062 3.0E-24
sp|Q0P5J8|STRP1_BOVIN Striatin-interacting protein 1 OS=Bos taurus GN=STRIP1 PE=2 SV=1 939 1062 3.0E-24
sp|Q8C079|STRP1_MOUSE Striatin-interacting protein 1 OS=Mus musculus GN=Strip1 PE=1 SV=2 939 1062 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8C9H6|STRP2_MOUSE Striatin-interacting proteins 2 OS=Mus musculus GN=Strip2 PE=1 SV=1 921 1062 9.0E-25
sp|Q9ULQ0|STRP2_HUMAN Striatin-interacting protein 2 OS=Homo sapiens GN=STRIP2 PE=1 SV=2 921 1062 1.0E-24
sp|Q9GLZ5|STRP1_MACFA Striatin-interacting protein 1 OS=Macaca fascicularis GN=STRIP1 PE=2 SV=1 939 1062 3.0E-24
sp|Q0P5J8|STRP1_BOVIN Striatin-interacting protein 1 OS=Bos taurus GN=STRIP1 PE=2 SV=1 939 1062 3.0E-24
sp|Q8C079|STRP1_MOUSE Striatin-interacting protein 1 OS=Mus musculus GN=Strip1 PE=1 SV=2 939 1062 3.0E-24
sp|Q5R7S4|STRP1_PONAB Striatin-interacting protein 1 OS=Pongo abelii GN=STRIP1 PE=2 SV=2 939 1062 3.0E-24
sp|Q5VSL9|STRP1_HUMAN Striatin-interacting protein 1 OS=Homo sapiens GN=STRIP1 PE=1 SV=1 939 1062 3.0E-24
sp|P53917|FAR11_YEAST Factor arrest protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR11 PE=1 SV=1 361 853 7.0E-24
sp|Q803T2|STRP1_DANRE Striatin-interacting protein 1 homolog OS=Danio rerio GN=strip1 PE=1 SV=1 939 1062 1.0E-23
sp|O13665|FAR11_SCHPO Factor arrest protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=far11 PE=1 SV=1 895 1093 1.0E-18
sp|Q54IL2|STRP_DICDI Striatin-interacting protein homolog OS=Dictyostelium discoideum GN=fam40 PE=3 SV=1 942 1031 3.0E-13
sp|O13665|FAR11_SCHPO Factor arrest protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=far11 PE=1 SV=1 359 592 7.0E-12
sp|P53917|FAR11_YEAST Factor arrest protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR11 PE=1 SV=1 951 1090 4.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4165
MWPPRHLTPTDDVADTGPSTDVGLSSDAPASALPTRPSLVRNSAQPLPPQPPPPAGLPPTHIPTRGGRGRGQQQQ
QQHQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPMPPPRGPPPQQPGQQQPQSLHFGPNDSLSLQQLRR
YVSDANRLDALVYDFEYSDMGPHAEEIDEWFVYSMPQWLRLHAAHKAFEWHWNNETGRSMVAWEDAEGDVRARFV
EAAIAGVQSNDAALRSASIGKIVYLVLGRWAETAMPSASSGPGTPVASQSQLQEVKAGVELLAALGGLPVVWEAL
RACFEASWSDDMQLQQPVSQEVQDELLNLMTIMYIAIQQTLHEAEAMAFVHTQLVELNPCLVDFMLTATAKLRWD
EQNVMPHAQMFLLFWKSILLVFGGSKEIDTLKKAVDEMGAASMDQETITATPLDYHVFRQEITSKYPAYVPPRPP
LPFDTENNSLLPPLPNQSSRSNAVSGILPTPAHAQSGGASILHQPVHIATPAPSPPPSPGLGGKGVKKQNYQTNQ
NLPFFYPPLDETSNTAGGKGPSAVHGALVSRKWEGSDIPVSILEAGELYSSRVRMTRATRQLWEERESFLKYERG
WVQDDELMAAVDDDQDDDKDSYYSIEELDLDLSDMTMEEIELVREFKHESKRKKTRRLPEVDVDLGPIPGRVSDR
DKQRLVAVEIFFRNALPHLQSLVIALLRPILANVTVIVTQQTMQMASGMATRGNNTGNNAGSSAQRPPEGQDETE
LPIEELDAARTREITAKAMTGILIMLLKWLKCSHILKFEYFTQLLLDSNYIPLVLKLFAHQDIQQVVDSRTDRVE
NSFFQFCNSNSNIKGRMDLDIDAEADEEEEEAKEAKEAPVELGTDDDAEQHDDDSAVPPPIKRRRSPPQEVDRSC
AVEGNEVEDYREKMAGWRPEVDELGYPVQDLPSKPISDFARRNLFSLINYLRVMHKICKNKAHRNLMLVQYKSSQ
ILRKSLRIPQQTLRLYTLKIFKNQVPYCGRKWRQSNMRVITAIYLHCRPELRDEWLAGSDIDAEVEGALPHEHAL
RSLTHWHNMRHYADKMAPDIRIALRAEQNFFTRELEKMGISWMDMGGDEAMSEAGLGEAGVTGV*
Coding >OphauB2|4165
ATGTGGCCGCCTCGCCACCTGACTCCTACCGACGATGTGGCCGACACGGGTCCGTCCACAGATGTTGGCTTGAGC
TCCGACGCGCCGGCTTCAGCTCTGCCAACGCGGCCCAGCCTTGTGCGCAACTCGGCCCAGCCGCTTCCCCCCCAG
CCGCCGCCTCCTGCTGGCCTACCACCTACGCACATACCGACCCGAGGAGGCCGAGGCCGCGGACAGCAGCAGCAG
CAGCAACATCAACATCAACAGCAACAGCAACAACAACAACAGCAGCAACAACAGCAACAACAACAGCAACAGCAG
CAGCAACAGCAACAACAACAGCAACAGCAGCAGCAGCAGCAGCCTATGCCGCCGCCCAGAGGGCCGCCGCCGCAG
CAGCCTGGACAACAACAGCCGCAGAGTCTGCACTTTGGCCCCAACGACTCTCTCTCTCTTCAGCAGCTACGCCGC
TATGTGTCGGATGCAAACCGCCTCGACGCCCTGGTGTACGACTTTGAGTATTCCGACATGGGCCCCCATGCCGAA
GAAATCGACGAGTGGTTTGTCTATTCGATGCCGCAATGGCTCCGCCTACATGCCGCGCACAAGGCCTTTGAATGG
CACTGGAACAATGAAACTGGAAGAAGCATGGTGGCTTGGGAAGATGCCGAGGGCGATGTGCGCGCTCGCTTCGTC
GAGGCTGCCATTGCCGGCGTCCAGTCCAACGATGCTGCTCTGCGCTCGGCTTCCATTGGCAAAATTGTCTATCTT
GTGCTCGGGCGCTGGGCCGAGACTGCCATGCCGAGTGCGTCGAGCGGTCCGGGCACGCCCGTTGCGAGCCAGTCA
CAGCTGCAAGAAGTCAAGGCTGGCGTCGAGTTGCTCGCCGCGCTTGGCGGCTTGCCTGTTGTTTGGGAGGCGTTG
CGCGCCTGCTTCGAGGCTTCGTGGTCCGACGACATGCAGCTGCAGCAGCCAGTATCCCAGGAAGTTCAAGACGAA
TTGCTCAACCTCATGACCATTATGTACATTGCCATTCAACAGACATTACATGAAGCAGAGGCCATGGCTTTTGTC
CACACACAACTTGTTGAGCTAAACCCTTGTCTCGTCGACTTTATGCTCACAGCAACAGCCAAGCTGCGCTGGGAT
GAACAAAATGTTATGCCGCATGCACAGATGTTTTTACTCTTTTGGAAATCAATACTGCTTGTTTTTGGCGGAAGC
AAGGAAATTGACACCCTGAAAAAGGCTGTTGACGAAATGGGCGCTGCTTCAATGGACCAAGAGACGATTACAGCG
ACGCCCCTCGACTACCACGTGTTTCGCCAGGAAATTACTTCCAAGTATCCGGCATATGTTCCCCCGAGGCCGCCG
CTCCCCTTTGACACAGAGAATAACTCGCTGCTACCTCCGCTACCAAACCAGAGTAGTAGAAGCAACGCGGTTAGC
GGTATCCTCCCCACGCCAGCCCATGCGCAGAGTGGTGGGGCTTCGATACTGCATCAGCCCGTTCATATTGCTACT
CCAGCGCCCTCTCCGCCTCCTTCGCCAGGTCTCGGGGGAAAGGGTGTCAAGAAACAGAATTACCAGACGAACCAG
AACCTCCCCTTTTTTTATCCGCCTTTGGACGAGACGAGCAACACGGCTGGAGGCAAGGGCCCTTCTGCTGTCCAT
GGCGCTCTTGTAAGTCGCAAATGGGAAGGAAGCGACATCCCAGTCTCCATCTTGGAGGCTGGCGAGCTCTACTCT
TCACGCGTCAGGATGACGCGCGCAACCAGGCAGCTATGGGAAGAGCGCGAGAGTTTTCTCAAGTATGAGCGTGGC
TGGGTCCAAGACGATGAGCTCATGGCAGCGGTAGATGACGACCAAGACGACGACAAGGACAGTTACTATAGCATA
GAGGAACTCGACCTCGACCTCAGTGACATGACCATGGAGGAAATTGAACTGGTTCGCGAGTTTAAGCACGAATCC
AAGAGGAAGAAGACGCGCCGCCTGCCAGAGGTGGATGTTGATCTTGGTCCAATTCCTGGTCGTGTCAGTGATCGG
GATAAACAAAGGCTTGTTGCTGTTGAAATTTTTTTTCGCAATGCCCTTCCTCACCTGCAGTCGCTAGTCATTGCT
CTCTTGCGACCCATCTTGGCCAATGTAACTGTAATTGTTACGCAACAGACGATGCAGATGGCTAGTGGAATGGCT
ACCAGAGGTAACAATACTGGTAATAATGCTGGCTCTTCTGCTCAACGGCCCCCAGAAGGCCAGGATGAAACAGAA
CTGCCAATTGAGGAGCTTGATGCAGCAAGAACCAGGGAGATTACCGCAAAAGCCATGACGGGCATTCTCATCATG
CTGCTCAAGTGGCTCAAGTGTTCTCACATTCTCAAATTTGAGTACTTTACTCAACTGCTCCTCGACTCCAACTAC
ATCCCCCTCGTGCTAAAACTATTCGCACACCAAGACATTCAGCAGGTGGTGGATAGCAGGACAGACCGCGTGGAA
AACAGCTTTTTCCAATTTTGTAATTCCAACTCGAATATTAAGGGCAGAATGGACCTGGATATAGATGCAGAAGCG
GATGAAGAGGAGGAAGAAGCAAAGGAAGCTAAAGAGGCGCCAGTTGAGTTGGGAACCGATGATGACGCAGAGCAG
CACGATGATGATAGCGCTGTTCCTCCTCCAATTAAGAGACGCCGCTCGCCGCCACAAGAGGTGGACAGAAGCTGT
GCAGTGGAAGGGAACGAAGTAGAGGACTACCGGGAAAAGATGGCCGGGTGGCGGCCCGAGGTGGACGAACTCGGA
TACCCGGTGCAGGATCTGCCGTCCAAGCCCATAAGCGACTTTGCCCGGCGCAACCTCTTTTCACTCATCAACTAC
CTACGGGTCATGCACAAGATTTGCAAGAACAAGGCACATCGTAACCTGATGTTGGTACAGTACAAATCGTCGCAA
ATTCTGCGTAAGTCGCTACGAATACCACAGCAGACGCTGCGACTGTACACGCTCAAAATCTTCAAGAACCAAGTG
CCCTACTGCGGACGCAAGTGGCGGCAAAGCAACATGCGCGTCATTACTGCCATTTATCTGCACTGCAGGCCCGAG
CTACGCGACGAGTGGCTGGCGGGAAGCGATATCGACGCCGAGGTGGAGGGAGCGCTGCCTCACGAACACGCATTG
CGCAGCCTGACGCATTGGCACAATATGCGGCACTATGCAGACAAGATGGCGCCGGATATTCGCATTGCTCTGCGG
GCCGAGCAAAACTTTTTTACGCGAGAGCTGGAAAAGATGGGCATTAGTTGGATGGATATGGGCGGCGACGAGGCC
ATGAGCGAGGCTGGCCTTGGTGAGGCTGGCGTGACGGGCGTGTGA
Transcript >OphauB2|4165
ATGTGGCCGCCTCGCCACCTGACTCCTACCGACGATGTGGCCGACACGGGTCCGTCCACAGATGTTGGCTTGAGC
TCCGACGCGCCGGCTTCAGCTCTGCCAACGCGGCCCAGCCTTGTGCGCAACTCGGCCCAGCCGCTTCCCCCCCAG
CCGCCGCCTCCTGCTGGCCTACCACCTACGCACATACCGACCCGAGGAGGCCGAGGCCGCGGACAGCAGCAGCAG
CAGCAACATCAACATCAACAGCAACAGCAACAACAACAACAGCAGCAACAACAGCAACAACAACAGCAACAGCAG
CAGCAACAGCAACAACAACAGCAACAGCAGCAGCAGCAGCAGCCTATGCCGCCGCCCAGAGGGCCGCCGCCGCAG
CAGCCTGGACAACAACAGCCGCAGAGTCTGCACTTTGGCCCCAACGACTCTCTCTCTCTTCAGCAGCTACGCCGC
TATGTGTCGGATGCAAACCGCCTCGACGCCCTGGTGTACGACTTTGAGTATTCCGACATGGGCCCCCATGCCGAA
GAAATCGACGAGTGGTTTGTCTATTCGATGCCGCAATGGCTCCGCCTACATGCCGCGCACAAGGCCTTTGAATGG
CACTGGAACAATGAAACTGGAAGAAGCATGGTGGCTTGGGAAGATGCCGAGGGCGATGTGCGCGCTCGCTTCGTC
GAGGCTGCCATTGCCGGCGTCCAGTCCAACGATGCTGCTCTGCGCTCGGCTTCCATTGGCAAAATTGTCTATCTT
GTGCTCGGGCGCTGGGCCGAGACTGCCATGCCGAGTGCGTCGAGCGGTCCGGGCACGCCCGTTGCGAGCCAGTCA
CAGCTGCAAGAAGTCAAGGCTGGCGTCGAGTTGCTCGCCGCGCTTGGCGGCTTGCCTGTTGTTTGGGAGGCGTTG
CGCGCCTGCTTCGAGGCTTCGTGGTCCGACGACATGCAGCTGCAGCAGCCAGTATCCCAGGAAGTTCAAGACGAA
TTGCTCAACCTCATGACCATTATGTACATTGCCATTCAACAGACATTACATGAAGCAGAGGCCATGGCTTTTGTC
CACACACAACTTGTTGAGCTAAACCCTTGTCTCGTCGACTTTATGCTCACAGCAACAGCCAAGCTGCGCTGGGAT
GAACAAAATGTTATGCCGCATGCACAGATGTTTTTACTCTTTTGGAAATCAATACTGCTTGTTTTTGGCGGAAGC
AAGGAAATTGACACCCTGAAAAAGGCTGTTGACGAAATGGGCGCTGCTTCAATGGACCAAGAGACGATTACAGCG
ACGCCCCTCGACTACCACGTGTTTCGCCAGGAAATTACTTCCAAGTATCCGGCATATGTTCCCCCGAGGCCGCCG
CTCCCCTTTGACACAGAGAATAACTCGCTGCTACCTCCGCTACCAAACCAGAGTAGTAGAAGCAACGCGGTTAGC
GGTATCCTCCCCACGCCAGCCCATGCGCAGAGTGGTGGGGCTTCGATACTGCATCAGCCCGTTCATATTGCTACT
CCAGCGCCCTCTCCGCCTCCTTCGCCAGGTCTCGGGGGAAAGGGTGTCAAGAAACAGAATTACCAGACGAACCAG
AACCTCCCCTTTTTTTATCCGCCTTTGGACGAGACGAGCAACACGGCTGGAGGCAAGGGCCCTTCTGCTGTCCAT
GGCGCTCTTGTAAGTCGCAAATGGGAAGGAAGCGACATCCCAGTCTCCATCTTGGAGGCTGGCGAGCTCTACTCT
TCACGCGTCAGGATGACGCGCGCAACCAGGCAGCTATGGGAAGAGCGCGAGAGTTTTCTCAAGTATGAGCGTGGC
TGGGTCCAAGACGATGAGCTCATGGCAGCGGTAGATGACGACCAAGACGACGACAAGGACAGTTACTATAGCATA
GAGGAACTCGACCTCGACCTCAGTGACATGACCATGGAGGAAATTGAACTGGTTCGCGAGTTTAAGCACGAATCC
AAGAGGAAGAAGACGCGCCGCCTGCCAGAGGTGGATGTTGATCTTGGTCCAATTCCTGGTCGTGTCAGTGATCGG
GATAAACAAAGGCTTGTTGCTGTTGAAATTTTTTTTCGCAATGCCCTTCCTCACCTGCAGTCGCTAGTCATTGCT
CTCTTGCGACCCATCTTGGCCAATGTAACTGTAATTGTTACGCAACAGACGATGCAGATGGCTAGTGGAATGGCT
ACCAGAGGTAACAATACTGGTAATAATGCTGGCTCTTCTGCTCAACGGCCCCCAGAAGGCCAGGATGAAACAGAA
CTGCCAATTGAGGAGCTTGATGCAGCAAGAACCAGGGAGATTACCGCAAAAGCCATGACGGGCATTCTCATCATG
CTGCTCAAGTGGCTCAAGTGTTCTCACATTCTCAAATTTGAGTACTTTACTCAACTGCTCCTCGACTCCAACTAC
ATCCCCCTCGTGCTAAAACTATTCGCACACCAAGACATTCAGCAGGTGGTGGATAGCAGGACAGACCGCGTGGAA
AACAGCTTTTTCCAATTTTGTAATTCCAACTCGAATATTAAGGGCAGAATGGACCTGGATATAGATGCAGAAGCG
GATGAAGAGGAGGAAGAAGCAAAGGAAGCTAAAGAGGCGCCAGTTGAGTTGGGAACCGATGATGACGCAGAGCAG
CACGATGATGATAGCGCTGTTCCTCCTCCAATTAAGAGACGCCGCTCGCCGCCACAAGAGGTGGACAGAAGCTGT
GCAGTGGAAGGGAACGAAGTAGAGGACTACCGGGAAAAGATGGCCGGGTGGCGGCCCGAGGTGGACGAACTCGGA
TACCCGGTGCAGGATCTGCCGTCCAAGCCCATAAGCGACTTTGCCCGGCGCAACCTCTTTTCACTCATCAACTAC
CTACGGGTCATGCACAAGATTTGCAAGAACAAGGCACATCGTAACCTGATGTTGGTACAGTACAAATCGTCGCAA
ATTCTGCGTAAGTCGCTACGAATACCACAGCAGACGCTGCGACTGTACACGCTCAAAATCTTCAAGAACCAAGTG
CCCTACTGCGGACGCAAGTGGCGGCAAAGCAACATGCGCGTCATTACTGCCATTTATCTGCACTGCAGGCCCGAG
CTACGCGACGAGTGGCTGGCGGGAAGCGATATCGACGCCGAGGTGGAGGGAGCGCTGCCTCACGAACACGCATTG
CGCAGCCTGACGCATTGGCACAATATGCGGCACTATGCAGACAAGATGGCGCCGGATATTCGCATTGCTCTGCGG
GCCGAGCAAAACTTTTTTACGCGAGAGCTGGAAAAGATGGGCATTAGTTGGATGGATATGGGCGGCGACGAGGCC
ATGAGCGAGGCTGGCCTTGGTGAGGCTGGCGTGACGGGCGTGTGA
Gene >OphauB2|4165
ATGTGGCCGCCTCGCCACCTGACTCCTACCGACGATGTGGCCGACACGGGTCCGTCCACAGATGTTGGCTTGAGC
TCCGACGCGCCGGCTTCAGCTCTGCCAACGCGGCCCAGCCTTGTGCGCAACTCGGCCCAGCCGCTTCCCCCCCAG
CCGCCGCCTCCTGCTGGCCTACCACCTACGCACATACCGACCCGAGGAGGCCGAGGCCGCGGACAGCAGCAGCAG
CAGCAACATCAACATCAACAGCAACAGCAACAACAACAACAGCAGCAACAACAGCAACAACAACAGCAACAGCAG
CAGCAACAGCAACAACAACAGCAACAGCAGCAGCAGCAGCAGCCTATGCCGCCGCCCAGAGGGCCGCCGCCGCAG
CAGCCTGGACAACAACAGCCGCAGAGTCTGCACTTTGGCCCCAACGACTCTCTCTCTCTTCAGCAGCTACGCCGC
TATGTGTCGGATGCAAACCGCCTCGACGCCCTGGTGTACGACTTTGAGTATTCCGACATGGGCCCCCATGCCGAA
GAAATCGACGAGTGGTTTGTCTATTCGATGCCGCAATGGCTCCGCCTACATGCCGCGCACAAGGCCTTTGAATGG
CACTGGAACAATGAAACTGGAAGAAGCATGGTGGCTTGGGAAGATGCCGAGGGCGATGTGCGCGCTCGCTTCGTC
GAGGCTGCCATTGCCGGCGTCCAGTCCAACGATGCTGCTCTGCGCTCGGCTTCCATTGGCAAAATTGTCTATCTT
GTGCTCGGGCGCTGGGCCGAGACTGCCATGCCGAGTGCGTCGAGCGGTCCGGGCACGCCCGTTGCGAGCCAGTCA
CAGCTGCAAGAAGTCAAGGCTGGCGTCGAGTTGCTCGCCGCGCTTGGCGGCTTGCCTGTTGTTTGGGAGGCGTTG
CGCGCCTGCTTCGAGGCTTCGTGGTGGGCTTGCCTCAGCTTTACAGGCCACCCCGAGGAGTGCCAGGAGCTAACG
CTTGCTAGGTCCGACGACATGCAGCTGCAGCAGCCAGTATCCCAGGAAGTTCAAGACGAATTGCTCAACCTCATG
ACCATTATGTACATTGCCATTCAACAGACATTACATGAAGCAGAGGCCATGGCTTTTGTCCACACACAACTTGGT
CAGTCCTCTCAGCCTCCCCTTGACGGGGAAAGACTTGCTAAATAAATGCCTAGTTGAGCTAAACCCTTGTCTCGT
CGACTTTATGCTCACAGCAACAGCCAAGCTGCGCTGGGATGAACAAAATGTTATGCCGCATGCACAGGTCCGTCG
CTATTTTAGAGATTGTTGTTATGCCAAGAAGCGCTTTCTGATTCGAGCAGATGTTTTTACTCTTTTGGAAATCAA
TACTGCTTGTTTTTGGCGGAAGCAAGGAAATTGACACCCTGAAAAAGGCTGTTGACGAAATGGGCGCTGCTTCAA
TGGACCAAGAGACGATTACAGCGACGCCCCTCGACTACCACGTGTTTCGCCAGGAAATTACTTCCAAGTATCCGG
CATATGTTCCCCCGAGGCCGCCGCTCCCCTTTGACACAGAGAATAACTCGCTGCTACCTCCGCTACCAAACCAGA
GTAGTAGAAGCAACGCGGTTAGCGGTATCCTCCCCACGCCAGCCCATGCGCAGAGTGGTGGGGCTTCGATACTGC
ATCAGCCCGTTCATATTGCTACTCCAGCGCCCTCTCCGCCTCCTTCGCCAGGTCTCGGGGGAAAGGGTGTCAAGA
AACAGAATTACCAGACGAACCAGAACCTCCCCTTTTTTTATCCGCCTTTGGACGAGACGAGCAACACGGCTGGAG
GCAAGGGCCCTTCTGCTGTCCATGGCGCTCTTGTAAGTCGCAAATGGGAAGGAAGCGACATCCCAGTCTCCATCT
TGGAGGCTGGCGAGCTCTACTCTTCACGCGTCAGGATGACGCGCGCAACCAGGCAGCTATGGGAAGAGCGCGAGA
GTTTTCTCAAGTATGAGCGTGGCTGGGTCCAAGACGATGAGCTCATGGCAGCGGTAGATGACGACCAAGACGACG
ACAAGGACAGTTACTATAGCATAGAGGAACTCGACCTCGACCTCAGTGACATGACCATGGAGGAAATTGAACTGG
TTCGCGAGTTTAAGCACGAATCCAAGAGGAAGAAGACGCGCCGCCTGCCAGAGGTGGATGTTGATCTTGGTCCAA
TTCCTGGTCGTGTCAGTGATCGGGATAAACAAAGGCTTGTTGCTGTTGAAATTTTTTTTGTAAGCCTAATGTCTT
TTTCCTCGAGGCTGCCGTCATTGGTGTGTATTGACCATGAACTGACCACCATGATGCAGCGCAATGCCCTTCCTC
ACCTGCAGTCGCTAGTCATTGCTCTCTTGCGACCCATCTTGGCCAATGTAACTGTAATTGTTACGCAACAGACGA
TGCAGATGGCTAGTGGAATGGCTACCAGAGGTAACAATACTGGTAATAATGCTGGCTCTTCTGCTCAACGGCCCC
CAGAAGGCCAGGATGAAACAGAACTGCCAATTGAGGAGCTTGATGCAGCAAGAACCAGGGAGATTACCGCAAAAG
CCATGACGGGCATTCTCATCATGCTGCTCAAGTGGCTCAAGTGTTCTCGTGAGTCTCTTTTTTTTTCAAGTTCCA
AACTGACGGTGGGCTGACAATGACTGAATTGTACAGACATTCTCAAATTTGAGTACTTTACTCAACTGCTCCTCG
ACTCCAACTACATCCCCCTCGTGCTAAAACTATTCGCACACCAAGACATTCAGCAGGTGGTGGATAGCAGGACAG
ACCGCGTGGAAAACAGGTGAGATGGCGCAACTGCCTGGCATGCGTCCAATCAAGACTTGGAGCTGACAGAGGATA
GCTTTTTCCAATTTTGTAATTCCAACTCGAATATTAAGGGCAGAATGGACCTGGATATAGATGCAGAAGCGGATG
AAGAGGAGGAAGAAGCAAAGGAAGCTAAAGAGGCGCCAGTTGAGTTGGGAACCGATGATGACGCAGAGCAGCACG
ATGATGATAGCGCTGTTCCTCCTCCAATTAAGAGACGCCGCTCGCCGCCACAAGAGGTGGACAGAAGCTGTGCAG
TGGAAGGGAACGAAGTAGAGGACTACCGGGAAAAGATGGCCGGGTGGCGGCCCGAGGTGGACGAACTCGGATACC
CGGTGCAGGATCTGCCGTCCAAGCCCATAAGCGACTTTGCCCGGCGCAACCTCTTTTCACTCATCAACTACCTAC
GGGTCATGCACAAGATTTGCAAGAACAAGGCACATCGTAACCTGATGTTGGTACAGTACAAATCGTCGCAAATTC
TGCGTAAGTCGCTACGAATACCACAGCAGACGCTGCGACTGTACACGCTCAAAATCTTCAAGAACCAAGTGCCCT
ACTGCGGACGCAAGTGGCGGCAAAGCAACATGCGCGTCATTACTGCCATTTATCTGCACTGCAGGCCCGAGCTAC
GCGACGAGTGGCTGGCGGGAAGCGATATCGACGCCGAGGTGGAGGGAGCGCTGCCTCACGAACACGCATTGCGCA
GCCTGACGCATTGGCACAATATGCGGCACTATGCAGACAAGATGGCGCCGGATATTCGCATTGCTCTGCGGGCCG
AGCAAAACTTTTTTACGCGAGAGCTGGAAAAGATGGGCATTAGTTGGATGGATATGGGCGGCGACGAGGCCATGA
GCGAGGCTGGCCTTGGTGAGGCTGGCGTGACGGGCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail