Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4163
Gene name
LocationContig_273:54..1988
Strand-
Gene length (bp)1934
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.3E-22 58 246

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1 529 3.0E-134
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 60 236 2.0E-16
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 67 240 3.0E-13
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 62 193 4.0E-13
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 43 240 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1 529 3.0E-134
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 60 236 2.0E-16
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 67 240 3.0E-13
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 62 193 4.0E-13
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 43 240 2.0E-12
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 67 247 1.0E-10
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 67 247 1.0E-10
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 67 240 4.0E-10
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 67 308 9.0E-10
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 67 240 1.0E-09
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 67 247 2.0E-09
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 67 247 2.0E-09
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 67 254 7.0E-09
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 67 304 1.0E-08
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 67 247 2.0E-08
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 67 291 5.0E-08
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 67 291 5.0E-08
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 67 198 6.0E-08
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 67 198 1.0E-07
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 67 199 1.0E-07
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 67 257 1.0E-07
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 63 235 1.0E-07
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 67 257 2.0E-07
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 67 237 3.0E-07
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 67 198 3.0E-07
sp|Q4PD66|CCPR2_USTMA Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP2 PE=3 SV=1 67 250 1.0E-06
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 67 257 2.0E-06
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 61 239 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0050896 response to stimulus No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016209 antioxidant activity No
GO:0006950 response to stress No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4163
MRSLSALLALGLAGSALADPTWPSDVDELEEIMYQLTSFRARKFADTVSPCSSEASGPGRHNAAEWLRTAFHDMS
TANSFFHLGGLDASLQYELENGENTGPGHKTTLQFMSPYVSPRCSLSDLVAMGVYMSVRSCGGPAVPIRAGRKDA
TQKGPAGVPQPQNSVFTFKQQFQRMGFTNEEMIQVTACGHTLGGVHKDEFPELMPAAGVKNGEAPSDETPTVFDN
KVVTEYLAGKTQNPLVVGPSAKINKNSDSKVFDSDGNKTLQAMADAEQFNAVCQKVLQKMIDVVPPGVTLTDPIE
PYMVKPVNLQLTLVNGGRELALSGYIRVRTTELARESIKNITLTYKGRSGSSQCASSSCTVTSTIQGVGRGFDDS
FAFFPISTRIPASSGISSFIVTINKADGTRETHDNNGEAYPLHDDVVFQAPQSCVRGSSGSLTVVAAVRNEAAAQ
GAKANVWYRVPQTNSPVPQLKKTTIDLVKGQCVGQYTLFSADYKIEGGLAYQSYVDVMAGDKSDAFKSVAGLGGT
CGVFEGAVSCQDVERQLSRRGVEAKVFERQVNATTSTAPVTTAPPPTTSTTAPVPTATRAPPSHRPAVGGYKLVS
CWTEGNNCICLLGHRVWARV*
Coding >OphauB2|4163
ATGCGATCCCTTTCGGCCTTGCTGGCCCTAGGTCTCGCCGGCTCAGCACTGGCAGACCCAACATGGCCTTCGGAC
GTGGATGAGCTCGAGGAAATCATGTACCAGCTGACGTCGTTTCGGGCGCGCAAGTTTGCCGATACAGTGAGCCCC
TGCTCTAGCGAGGCTTCGGGCCCGGGGCGGCACAACGCGGCCGAGTGGCTGCGGACTGCCTTTCACGACATGTCG
ACGGCCAACTCATTCTTCCACCTTGGCGGCCTCGACGCCTCGCTGCAGTACGAGCTGGAGAATGGCGAGAACACG
GGGCCCGGCCACAAGACGACGCTGCAGTTCATGTCGCCGTATGTCTCGCCGCGCTGCAGTCTTTCTGACCTGGTG
GCCATGGGCGTCTACATGTCTGTCCGCTCGTGTGGCGGCCCAGCCGTTCCCATTCGCGCGGGCAGAAAGGACGCC
ACGCAAAAGGGGCCGGCCGGAGTCCCGCAGCCGCAAAACTCCGTCTTTACCTTTAAGCAGCAGTTTCAGCGCATG
GGGTTTACCAATGAAGAGATGATCCAGGTGACGGCCTGTGGCCACACCCTCGGCGGCGTCCACAAGGACGAGTTT
CCTGAGCTGATGCCTGCAGCCGGCGTCAAGAATGGAGAGGCGCCATCTGACGAGACGCCCACCGTCTTTGACAAC
AAGGTGGTGACGGAGTATCTTGCCGGCAAGACGCAGAATCCTCTGGTCGTGGGTCCCTCGGCCAAGATTAACAAG
AACTCGGACTCAAAGGTCTTTGACTCTGACGGCAACAAGACGCTGCAGGCCATGGCAGACGCCGAGCAGTTCAAT
GCCGTGTGCCAAAAGGTGCTGCAAAAAATGATTGACGTGGTGCCGCCCGGCGTCACGCTGACGGATCCCATTGAG
CCCTACATGGTCAAGCCAGTCAACCTGCAGCTAACATTGGTCAATGGAGGCCGCGAGCTGGCACTGAGTGGATAC
ATTCGCGTCAGGACGACTGAATTGGCGCGCGAGAGCATCAAGAACATCACGTTGACGTACAAGGGCCGCTCTGGC
TCATCCCAGTGCGCCTCAAGCTCGTGCACAGTGACGAGTACCATTCAAGGCGTTGGACGCGGCTTTGACGACAGC
TTTGCCTTTTTCCCAATCTCAACAAGGATTCCCGCCTCATCGGGCATCTCGTCCTTTATCGTCACCATCAACAAG
GCCGACGGCACAAGAGAGACGCACGACAACAATGGCGAGGCATACCCCTTGCACGACGACGTGGTCTTCCAGGCA
CCGCAAAGCTGTGTGCGAGGGTCCAGCGGCTCGCTGACCGTTGTGGCGGCTGTGCGCAACGAGGCAGCGGCGCAG
GGAGCCAAGGCCAATGTCTGGTATCGGGTGCCCCAGACCAACAGCCCCGTGCCGCAACTCAAGAAGACGACGATT
GACCTGGTCAAGGGCCAGTGCGTTGGCCAGTACACGCTGTTTAGCGCAGACTACAAGATTGAGGGCGGACTGGCC
TATCAGTCATATGTCGATGTCATGGCTGGTGACAAGTCGGATGCCTTTAAGAGCGTTGCTGGTCTTGGCGGCACC
TGCGGCGTCTTTGAGGGCGCAGTCAGCTGTCAAGATGTCGAGCGGCAGCTCTCGCGCAGAGGCGTCGAGGCCAAG
GTGTTTGAGCGCCAGGTTAATGCCACGACAAGCACTGCTCCCGTGACAACGGCGCCGCCCCCAACAACTAGCACG
ACTGCTCCTGTGCCCACGGCCACTCGGGCTCCTCCAAGTCACCGCCCAGCCGTTGGCGGGTACAAGCTGGTGTCG
TGCTGGACAGAGGGCAACAATTGCATATGTCTATTGGGGCACCGAGTATGGGCGCGAGTGTAA
Transcript >OphauB2|4163
ATGCGATCCCTTTCGGCCTTGCTGGCCCTAGGTCTCGCCGGCTCAGCACTGGCAGACCCAACATGGCCTTCGGAC
GTGGATGAGCTCGAGGAAATCATGTACCAGCTGACGTCGTTTCGGGCGCGCAAGTTTGCCGATACAGTGAGCCCC
TGCTCTAGCGAGGCTTCGGGCCCGGGGCGGCACAACGCGGCCGAGTGGCTGCGGACTGCCTTTCACGACATGTCG
ACGGCCAACTCATTCTTCCACCTTGGCGGCCTCGACGCCTCGCTGCAGTACGAGCTGGAGAATGGCGAGAACACG
GGGCCCGGCCACAAGACGACGCTGCAGTTCATGTCGCCGTATGTCTCGCCGCGCTGCAGTCTTTCTGACCTGGTG
GCCATGGGCGTCTACATGTCTGTCCGCTCGTGTGGCGGCCCAGCCGTTCCCATTCGCGCGGGCAGAAAGGACGCC
ACGCAAAAGGGGCCGGCCGGAGTCCCGCAGCCGCAAAACTCCGTCTTTACCTTTAAGCAGCAGTTTCAGCGCATG
GGGTTTACCAATGAAGAGATGATCCAGGTGACGGCCTGTGGCCACACCCTCGGCGGCGTCCACAAGGACGAGTTT
CCTGAGCTGATGCCTGCAGCCGGCGTCAAGAATGGAGAGGCGCCATCTGACGAGACGCCCACCGTCTTTGACAAC
AAGGTGGTGACGGAGTATCTTGCCGGCAAGACGCAGAATCCTCTGGTCGTGGGTCCCTCGGCCAAGATTAACAAG
AACTCGGACTCAAAGGTCTTTGACTCTGACGGCAACAAGACGCTGCAGGCCATGGCAGACGCCGAGCAGTTCAAT
GCCGTGTGCCAAAAGGTGCTGCAAAAAATGATTGACGTGGTGCCGCCCGGCGTCACGCTGACGGATCCCATTGAG
CCCTACATGGTCAAGCCAGTCAACCTGCAGCTAACATTGGTCAATGGAGGCCGCGAGCTGGCACTGAGTGGATAC
ATTCGCGTCAGGACGACTGAATTGGCGCGCGAGAGCATCAAGAACATCACGTTGACGTACAAGGGCCGCTCTGGC
TCATCCCAGTGCGCCTCAAGCTCGTGCACAGTGACGAGTACCATTCAAGGCGTTGGACGCGGCTTTGACGACAGC
TTTGCCTTTTTCCCAATCTCAACAAGGATTCCCGCCTCATCGGGCATCTCGTCCTTTATCGTCACCATCAACAAG
GCCGACGGCACAAGAGAGACGCACGACAACAATGGCGAGGCATACCCCTTGCACGACGACGTGGTCTTCCAGGCA
CCGCAAAGCTGTGTGCGAGGGTCCAGCGGCTCGCTGACCGTTGTGGCGGCTGTGCGCAACGAGGCAGCGGCGCAG
GGAGCCAAGGCCAATGTCTGGTATCGGGTGCCCCAGACCAACAGCCCCGTGCCGCAACTCAAGAAGACGACGATT
GACCTGGTCAAGGGCCAGTGCGTTGGCCAGTACACGCTGTTTAGCGCAGACTACAAGATTGAGGGCGGACTGGCC
TATCAGTCATATGTCGATGTCATGGCTGGTGACAAGTCGGATGCCTTTAAGAGCGTTGCTGGTCTTGGCGGCACC
TGCGGCGTCTTTGAGGGCGCAGTCAGCTGTCAAGATGTCGAGCGGCAGCTCTCGCGCAGAGGCGTCGAGGCCAAG
GTGTTTGAGCGCCAGGTTAATGCCACGACAAGCACTGCTCCCGTGACAACGGCGCCGCCCCCAACAACTAGCACG
ACTGCTCCTGTGCCCACGGCCACTCGGGCTCCTCCAAGTCACCGCCCAGCCGTTGGCGGGTACAAGCTGGTGTCG
TGCTGGACAGAGGGCAACAATTGCATATGTCTATTGGGGCACCGAGTATGGGCGCGAGTGTAA
Gene >OphauB2|4163
ATGCGATCCCTTTCGGCCTTGCTGGCCCTAGGTCTCGCCGGCTCAGCACTGGCAGACCCAACATGGCCTTCGGAC
GTGGATGAGCTCGAGGAAATCATGTACCAGCTGACGTCGTTTCGGGCGCGCAAGTTTGCCGATACAGTGAGCCCC
TGCTCTAGCGAGGCTTCGGGCCCGGGGCGGCACAACGCGGCCGAGTGGCTGCGGACTGCCTTTCACGACATGTCG
ACGGCCAACTCATTCTTCCACCTTGGCGGCCTCGACGCCTCGCTGCAGTACGAGCTGGAGAATGGCGAGAACACG
GGGCCCGGCCACAAGACGACGCTGCAGTTCATGTCGCCGTATGTCTCGCCGCGCTGCAGTCTTTCTGACCTGGTG
GCCATGGGCGTCTACATGTCTGTCCGCTCGTGTGGCGGCCCAGCCGTTCCCATTCGCGCGGGCAGAAAGGACGCC
ACGCAAAAGGGGCCGGCCGGAGTCCCGCAGCCGCAAAACTCCGTCTTTACCTTTAAGCAGCAGTTTCAGCGCATG
GGGTTTACCAATGAAGAGATGATCCAGGTGACGGCCTGTGGCCACACCCTCGGCGGCGTCCACAAGGACGAGTTT
CCTGAGCTGATGCCTGCAGCCGGCGTCAAGAATGGAGAGGCGCCATCTGACGAGACGCCCACCGTCTTTGACAAC
AAGGTGGTGACGGAGTATCTTGCCGGCAAGACGCAGAATCCTCTGGTCGTGGGTCCCTCGGCCAAGATTAACAAG
AACTCGGACTCAAAGGTCTTTGACTCTGACGGCAACAAGACGCTGCAGGCCATGGCAGACGCCGAGCAGTTCAAT
GCCGTGTGCCAAAAGGTGCTGCAAAAAATGATTGACGTGGTGCCGCCCGGCGTCACGCTGACGGATCCCATTGAG
CCCTACATGGTCAAGCCAGTCAACCTGCAGCTAACATTGGTCAATGGAGGCCGCGAGCTGGCACTGAGTGGATAC
ATTCGCGTCAGGACGACTGAATTGGCGCGCGAGAGCATCAAGAACATCACGTTGACGTACAAGGGCCGCTCTGGC
TCATCCCAGTGCGCCTCAAGCTCGTGCACAGTGACGAGTACCATTCAAGGCGTTGGACGCGGCTTTGACGACAGC
TTTGCCTTTTTCCCAATCTCAACAAGGATTCCCGCCTCATCGGGCATCTCGTCCTTTATCGTCACCATCAACAAG
GCCGACGGCACAAGAGAGACGCACGACAACAATGGCGAGGCATACCCCTTGCACGACGACGTGGTCTTCCAGGCA
CCGCAAAGCTGTGTGCGAGGGTCCAGCGGCTCGCTGACCGTTGTGGCGGCTGTGCGCAACGAGGCAGCGGCGCAG
GGAGCCAAGGCCAATGTCTGGTATCGGGTGCCCCAGACCAACAGCCCCGTGCCGCAACTCAAGAAGACGACGATT
GACCTGGTCAAGGGCCAGTGCGTTGGCCAGTACACGCTGTTTAGCGCAGACTACAAGATTGAGGGCGGACTGGCC
TATCAGTCATATGTCGATGTCATGGCTGGTGACAAGTCGGATGCCTTTAAGAGCGTTGCTGGTCTTGGCGGCACC
TGCGGCGTCTTTGAGGGCGCAGTCAGCTGTCAAGATGTCGAGCGGCAGCTCTCGCGCAGAGGCGTCGAGGCCAAG
GTGTTTGAGCGCCAGGTTAATGCCACGACAAGCACTGCTCCCGTGACAACGGCGCCGCCCCCAACAACTAGCACG
ACTGCTCCTGTGCCCACGGCCACTCGGGCTCCTCCAAGTCACCGCCCAGCCGTTGGCGGGTACAAGCTGGTGTCG
TGCTGGACAGAGGGCAACAATGTGCGTGCGCTCAATGGCATCTCGTTTGCCAATGACACCATGACGCTGGAAAAG
TGCATGAATTACTGCAGTGCATATGTCTATTGGGGCACCGAGTATGGGCGCGAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail