Protein ID | OphauB2|4160 |
Gene name | |
Location | Contig_272:7114..9082 |
Strand | - |
Gene length (bp) | 1968 |
Transcript length (bp) | 1821 |
Coding sequence length (bp) | 1821 |
Protein length (aa) | 607 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 2.2E-17 | 176 | 397 |
PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 2.5E-07 | 422 | 492 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|D2XV59|GTPB1_RAT | GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 | 55 | 600 | 6.0E-171 |
sp|Q58DC5|GTPB1_BOVIN | GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 | 55 | 600 | 1.0E-170 |
sp|O08582|GTPB1_MOUSE | GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 | 55 | 600 | 2.0E-170 |
sp|O00178|GTPB1_HUMAN | GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 | 55 | 600 | 2.0E-170 |
sp|Q5R8Q7|GTPB1_PONAB | GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 | 73 | 600 | 5.0E-170 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|D2XV59|GTPB1_RAT | GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 | 55 | 600 | 6.0E-171 |
sp|Q58DC5|GTPB1_BOVIN | GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 | 55 | 600 | 1.0E-170 |
sp|O08582|GTPB1_MOUSE | GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 | 55 | 600 | 2.0E-170 |
sp|O00178|GTPB1_HUMAN | GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 | 55 | 600 | 2.0E-170 |
sp|Q5R8Q7|GTPB1_PONAB | GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 | 73 | 600 | 5.0E-170 |
sp|Q5XGS8|GTPB1_XENLA | GTP-binding protein 1 OS=Xenopus laevis GN=gtpbp1 PE=2 SV=1 | 73 | 606 | 2.0E-159 |
sp|Q18905|CGP1_CAEEL | GTP-binding protein cgp-1 OS=Caenorhabditis elegans GN=cgp-1 PE=2 SV=2 | 65 | 589 | 1.0E-146 |
sp|Q17045|AGP1_ASCSU | GTP-binding protein AGP-1 OS=Ascaris suum GN=AGP-1 PE=2 SV=1 | 173 | 586 | 4.0E-142 |
sp|Q9BX10|GTPB2_HUMAN | GTP-binding protein 2 OS=Homo sapiens GN=GTPBP2 PE=1 SV=1 | 74 | 604 | 4.0E-131 |
sp|Q3UJK4|GTPB2_MOUSE | GTP-binding protein 2 OS=Mus musculus GN=Gtpbp2 PE=1 SV=1 | 74 | 586 | 6.0E-130 |
sp|Q5UR72|YR624_MIMIV | Putative GTP-binding protein R624 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R624 PE=3 SV=1 | 149 | 596 | 6.0E-55 |
sp|A3DMQ1|EF1A_STAMF | Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 | 177 | 586 | 1.0E-24 |
sp|Q18EY5|EF1A_HALWD | Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 | 176 | 573 | 2.0E-23 |
sp|P16018|EF1A_HALMA | Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 | 176 | 573 | 2.0E-22 |
sp|Q3IUD8|EF1A_NATPD | Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 | 176 | 564 | 4.0E-22 |
sp|A8ABM5|EF1A_IGNH4 | Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 | 177 | 586 | 5.0E-22 |
sp|P35021|EF1A_SULSO | Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 | 177 | 586 | 1.0E-21 |
sp|A4YCR6|EF1A_METS5 | Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-21 |
sp|Q9HM89|EF1A_HALSA | Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 | 176 | 573 | 2.0E-21 |
sp|B0R8C3|EF1A_HALS3 | Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 | 176 | 573 | 2.0E-21 |
sp|A2BN41|EF1A_HYPBU | Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 | 165 | 586 | 6.0E-21 |
sp|Q8TRC4|EF1A_METAC | Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 | 176 | 559 | 6.0E-20 |
sp|A8MAJ1|EF1A_CALMQ | Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 | 177 | 576 | 1.0E-19 |
sp|Q979T1|EF1A_THEVO | Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 | 177 | 556 | 4.0E-19 |
sp|Q6L202|EF1A_PICTO | Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 | 176 | 556 | 5.0E-19 |
sp|Q9YAV0|EF1A_AERPE | Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 | 177 | 586 | 1.0E-18 |
sp|P17196|EF1A_SULAC | Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 | 177 | 586 | 2.0E-18 |
sp|Q57770|EF1A_METJA | Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 | 177 | 585 | 2.0E-18 |
sp|A1RXW9|EF1A_THEPD | Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 | 177 | 591 | 8.0E-18 |
sp|P86939|EF1A2_TRYB2 | Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 | 173 | 589 | 1.0E-17 |
sp|P86934|EF1A1_TRYB2 | Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 | 173 | 589 | 1.0E-17 |
sp|Q8TYP6|EF1A_METKA | Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 | 165 | 585 | 2.0E-17 |
sp|O29325|EF1A_ARCFU | Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 | 165 | 589 | 2.0E-17 |
sp|A5ULM5|EF1A_METS3 | Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 | 165 | 585 | 2.0E-17 |
sp|Q976B1|EF1A_SULTO | Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 | 177 | 586 | 4.0E-17 |
sp|P19486|EF1A_THEAC | Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 | 177 | 571 | 4.0E-17 |
sp|P41203|EF1A_DESMO | Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 | 177 | 600 | 8.0E-17 |
sp|Q8PUR8|EF1A_METMA | Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 | 176 | 559 | 1.0E-16 |
sp|P33165|EFTU_BACFR | Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 | 235 | 589 | 2.0E-16 |
sp|Q5L890|EFTU_BACFN | Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 | 235 | 589 | 2.0E-16 |
sp|A7I656|EF1A_METB6 | Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 | 176 | 559 | 2.0E-16 |
sp|P02993|EF1A_ARTSA | Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 | 173 | 600 | 2.0E-16 |
sp|Q8KTA3|EFTU_RICRH | Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-16 |
sp|P29520|EF1A_BOMMO | Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 | 176 | 592 | 3.0E-16 |
sp|Q0W8G2|EF1A_METAR | Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 | 176 | 589 | 3.0E-16 |
sp|A8F2E9|EFTU_RICM5 | Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 | 265 | 589 | 3.0E-16 |
sp|A1RRJ3|EF1A_PYRIL | Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 | 177 | 571 | 4.0E-16 |
sp|A0RUM4|EF1A_CENSY | Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 | 176 | 589 | 4.0E-16 |
sp|P19039|EF1A_APIME | Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 | 173 | 592 | 4.0E-16 |
sp|O93729|EF1A_PYRAE | Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 | 177 | 571 | 4.0E-16 |
sp|P08736|EF1A1_DROME | Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 | 173 | 592 | 5.0E-16 |
sp|A5FZW7|EFTU_ACICJ | Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1 | 177 | 589 | 8.0E-16 |
sp|Q92GW4|EFTU_RICCN | Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-16 |
sp|P86933|EF1A_TRYBB | Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 | 173 | 589 | 1.0E-15 |
sp|P48865|EFTU_RICPR | Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 | 265 | 589 | 1.0E-15 |
sp|Q9YIC0|EF1A_ORYLA | Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 | 173 | 589 | 1.0E-15 |
sp|A8GT71|EFTU_RICRS | Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-15 |
sp|B0BUR2|EFTU_RICRO | Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-15 |
sp|C4K2I2|EFTU_RICPU | Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-15 |
sp|C3PPA9|EFTU_RICAE | Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-15 |
sp|A4WKK8|EF1A_PYRAR | Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 | 177 | 571 | 2.0E-15 |
sp|Q8KT95|EFTU_RICTY | Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 | 265 | 586 | 2.0E-15 |
sp|Q8A463|EFTU_BACTN | Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 | 235 | 589 | 2.0E-15 |
sp|Q8KT99|EFTU_RICHE | Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-15 |
sp|P0A3B0|EFTU_RICSI | Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-15 |
sp|P0A3A9|EFTU_RICRI | Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-15 |
sp|Q2NEL1|EF1A_METST | Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 | 176 | 559 | 2.0E-15 |
sp|A8EZL8|EFTU_RICCK | Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-15 |
sp|Q5GRY3|EFTU2_WOLTR | Elongation factor Tu 2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf2 PE=3 SV=1 | 265 | 589 | 3.0E-15 |
sp|B9K884|EFTU_THENN | Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-15 |
sp|Q9Y700|EFTU_SCHPO | Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 | 154 | 589 | 3.0E-15 |
sp|Q5GSU2|EFTU1_WOLTR | Elongation factor Tu 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf1 PE=3 SV=1 | 265 | 589 | 3.0E-15 |
sp|A6VGV6|EF1A_METM7 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 | 176 | 585 | 3.0E-15 |
sp|A9A9U3|EF1A_METM6 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 | 176 | 583 | 4.0E-15 |
sp|C5CGR6|EFTU_KOSOT | Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-15 |
sp|A4FWE9|EF1A_METM5 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 | 176 | 583 | 4.0E-15 |
sp|A4FPM7|EFTU_SACEN | Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-15 |
sp|A3MV69|EF1A_PYRCJ | Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 | 177 | 571 | 4.0E-15 |
sp|A8GPF2|EFTU_RICAH | Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-15 |
sp|A9BHA7|EFTU_PETMO | Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-15 |
sp|P13537|EFTU_THEMA | Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 | 265 | 589 | 6.0E-15 |
sp|B1LBP2|EFTU_THESQ | Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-15 |
sp|A5IM81|EFTU_THEP1 | Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-15 |
sp|A2STF0|EF1A_METLZ | Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 | 176 | 571 | 6.0E-15 |
sp|A0B7D6|EF1A_METTP | Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 | 177 | 559 | 7.0E-15 |
sp|B9KFF9|EFTU_CAMLR | Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 | 265 | 589 | 7.0E-15 |
sp|A6UQ14|EF1A_METVS | Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 | 176 | 585 | 1.0E-14 |
sp|A6LLL1|EFTU_THEM4 | Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-14 |
sp|P85834|EFTU_RAT | Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 | 177 | 595 | 2.0E-14 |
sp|C6A4R7|EF1A_THESM | Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-14 |
sp|Q2GFN6|EFTU_EHRCR | Elongation factor Tu OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-14 |
sp|P49411|EFTU_HUMAN | Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 | 177 | 588 | 2.0E-14 |
sp|P49410|EFTU_BOVIN | Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 | 177 | 586 | 2.0E-14 |
sp|Q8BFR5|EFTU_MOUSE | Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 | 177 | 595 | 2.0E-14 |
sp|A0LRL8|EFTU_ACIC1 | Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-14 |
sp|B8GIQ3|EF1A_METPE | Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 | 176 | 559 | 2.0E-14 |
sp|B3QY22|EFTU_CHLT3 | Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 | 176 | 589 | 2.0E-14 |
sp|A6KYK9|EFTU_BACV8 | Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-14 |
sp|A5FIJ9|EFTU_FLAJ1 | Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 | 176 | 589 | 3.0E-14 |
sp|P07810|EF1A_METVA | Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 | 176 | 585 | 3.0E-14 |
sp|Q6LXI1|EF1A_METMP | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 | 176 | 583 | 4.0E-14 |
sp|Q1LSY4|EFTU_BAUCH | Elongation factor Tu OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-14 |
sp|Q9ZK19|EFTU_HELPJ | Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-14 |
sp|B5Z8K3|EFTU_HELPG | Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-14 |
sp|Q3YRK7|EFTU_EHRCJ | Elongation factor Tu OS=Ehrlichia canis (strain Jake) GN=tuf1 PE=3 SV=1 | 265 | 589 | 4.0E-14 |
sp|P17508|EF1A3_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 | 173 | 571 | 4.0E-14 |
sp|P48864|EFTU_NEIGO | Elongation factor Tu OS=Neisseria gonorrhoeae GN=tuf PE=3 SV=1 | 233 | 589 | 4.0E-14 |
sp|Q2FRI3|EF1A_METHJ | Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 | 176 | 583 | 5.0E-14 |
sp|P42481|EFTU_THIDL | Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 | 233 | 589 | 5.0E-14 |
sp|Q2GJ61|EFTU_ANAPZ | Elongation factor Tu OS=Anaplasma phagocytophilum (strain HZ) GN=tuf1 PE=3 SV=1 | 233 | 589 | 5.0E-14 |
sp|Q464Z4|EF1A_METBF | Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 | 176 | 559 | 5.0E-14 |
sp|B2UUW8|EFTU_HELPS | Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-14 |
sp|P13549|EF1A0_XENLA | Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 | 176 | 571 | 6.0E-14 |
sp|P17507|EF1A2_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 | 173 | 571 | 6.0E-14 |
sp|Q2HJN6|EF1A3_OSCTI | Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 | 176 | 589 | 6.0E-14 |
sp|Q90835|EF1A_CHICK | Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 | 176 | 571 | 7.0E-14 |
sp|B7IHU4|EFTU_THEAB | Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-14 |
sp|Q47LJ1|EFTU_THEFY | Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-14 |
sp|A6Q1L5|EFTU_NITSB | Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-14 |
sp|Q1RHL9|EFTU_RICBR | Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 | 176 | 589 | 8.0E-14 |
sp|A8GVB2|EFTU_RICB8 | Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 | 176 | 589 | 8.0E-14 |
sp|O59153|EF1A_PYRHO | Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 | 165 | 569 | 8.0E-14 |
sp|Q8KTA1|EFTU_RICMO | Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-14 |
sp|Q46455|SELB_MOOTH | Selenocysteine-specific elongation factor OS=Moorella thermoacetica GN=selB PE=1 SV=1 | 177 | 576 | 8.0E-14 |
sp|Q8KTA6|EFTU_RICPA | Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-14 |
sp|Q9V0V7|EF1A_PYRAB | Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 | 165 | 573 | 9.0E-14 |
sp|Q5FTY1|EFTU_GLUOX | Elongation factor Tu OS=Gluconobacter oxydans (strain 621H) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-13 |
sp|Q83ES6|EFTU_COXBU | Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 | 265 | 589 | 1.0E-13 |
sp|A9NAK7|EFTU_COXBR | Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-13 |
sp|A9KD33|EFTU_COXBN | Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-13 |
sp|B6JN44|EFTU_HELP2 | Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-13 |
sp|A3CTG3|EF1A_METMJ | Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 | 176 | 562 | 1.0E-13 |
sp|Q5F5Q8|EFTU_NEIG1 | Elongation factor Tu OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tuf1 PE=3 SV=1 | 233 | 589 | 1.0E-13 |
sp|A9H3R7|EFTU_GLUDA | Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-13 |
sp|A6UV43|EF1A_META3 | Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 | 176 | 585 | 1.0E-13 |
sp|A1KRF9|EFTU_NEIMF | Elongation factor Tu OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tuf1 PE=3 SV=1 | 233 | 589 | 1.0E-13 |
sp|P64027|EFTU_NEIMB | Elongation factor Tu OS=Neisseria meningitidis serogroup B (strain MC58) GN=tufA PE=1 SV=1 | 233 | 589 | 1.0E-13 |
sp|P64026|EFTU_NEIMA | Elongation factor Tu OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tufA PE=3 SV=1 | 233 | 589 | 1.0E-13 |
sp|Q5HAS0|EFTU_EHRRW | Elongation factor Tu OS=Ehrlichia ruminantium (strain Welgevonden) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-13 |
sp|Q5FFE6|EFTU_EHRRG | Elongation factor Tu OS=Ehrlichia ruminantium (strain Gardel) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-13 |
sp|B0JSE0|EFTU_MICAN | Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 | 235 | 589 | 2.0E-13 |
sp|P68105|EF1A1_RABIT | Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 | 176 | 571 | 2.0E-13 |
sp|Q5R4R8|EF1A1_PONAB | Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 | 176 | 571 | 2.0E-13 |
sp|Q5R1X2|EF1A1_PANTR | Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 | 176 | 571 | 2.0E-13 |
sp|P68104|EF1A1_HUMAN | Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 | 176 | 571 | 2.0E-13 |
sp|Q66RN5|EF1A1_FELCA | Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 | 176 | 571 | 2.0E-13 |
sp|P68103|EF1A1_BOVIN | Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 | 176 | 571 | 2.0E-13 |
sp|P50256|EF1AC_PORPU | Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 | 165 | 589 | 2.0E-13 |
sp|P56003|EFTU_HELPY | Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-13 |
sp|P0CT32|EF1A2_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 | 177 | 588 | 2.0E-13 |
sp|P0CT31|EF1A1_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 | 177 | 588 | 2.0E-13 |
sp|P62630|EF1A1_RAT | Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 | 176 | 571 | 2.0E-13 |
sp|P10126|EF1A1_MOUSE | Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 | 176 | 571 | 2.0E-13 |
sp|P62629|EF1A1_CRIGR | Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 | 176 | 571 | 2.0E-13 |
sp|Q6YQV8|EFTU_ONYPE | Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-13 |
sp|Q2NJ20|EFTU_AYWBP | Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-13 |
sp|P43927|SELB_HAEIN | Selenocysteine-specific elongation factor OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=selB PE=3 SV=1 | 259 | 583 | 2.0E-13 |
sp|P14963|EF1A_EUGGR | Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 | 173 | 571 | 2.0E-13 |
sp|Q5VTE0|EF1A3_HUMAN | Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 | 176 | 571 | 2.0E-13 |
sp|Q2S1P8|EFTU_SALRD | Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 | 265 | 589 | 3.0E-13 |
sp|B0TX03|EFTU_FRAP2 | Elongation factor Tu OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tuf PE=3 SV=1 | 177 | 589 | 3.0E-13 |
sp|B2RL52|EFTU_PORG3 | Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-13 |
sp|A8Z5T8|EFTU_SULMW | Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 | 265 | 586 | 3.0E-13 |
sp|Q12WT3|EF1A_METBU | Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 | 176 | 569 | 3.0E-13 |
sp|O50340|EFTU_FERIS | Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-13 |
sp|O27132|EF1A_METTH | Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 | 165 | 587 | 5.0E-13 |
sp|Q71V39|EF1A2_RABIT | Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 | 176 | 589 | 5.0E-13 |
sp|Q05639|EF1A2_HUMAN | Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 | 176 | 589 | 5.0E-13 |
sp|Q32PH8|EF1A2_BOVIN | Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 | 176 | 589 | 5.0E-13 |
sp|P62632|EF1A2_RAT | Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 | 176 | 589 | 6.0E-13 |
sp|P62631|EF1A2_MOUSE | Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 | 176 | 589 | 6.0E-13 |
sp|Q1GP97|EFTU_SPHAL | Elongation factor Tu OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=tuf PE=3 SV=1 | 176 | 589 | 6.0E-13 |
sp|Q26487|EF1A_SPOFR | Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 | 182 | 556 | 6.0E-13 |
sp|P42482|EFTU_WOLSU | Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 | 265 | 589 | 6.0E-13 |
sp|Q5PBH1|EFTU_ANAMM | Elongation factor Tu OS=Anaplasma marginale (strain St. Maries) GN=tuf1 PE=3 SV=1 | 248 | 589 | 7.0E-13 |
sp|Q11Q98|EFTU_CYTH3 | Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 | 265 | 589 | 7.0E-13 |
sp|Q5WZL4|EFTU_LEGPL | Elongation factor Tu OS=Legionella pneumophila (strain Lens) GN=tuf1 PE=3 SV=1 | 265 | 589 | 7.0E-13 |
sp|Q59QD6|EF1A2_CANAL | Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 | 176 | 589 | 8.0E-13 |
sp|Q5ZYP5|EFTU_LEGPH | Elongation factor Tu OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tuf1 PE=3 SV=1 | 265 | 589 | 8.0E-13 |
sp|A5IHR6|EFTU_LEGPC | Elongation factor Tu OS=Legionella pneumophila (strain Corby) GN=tuf1 PE=3 SV=1 | 265 | 589 | 8.0E-13 |
sp|Q5X873|EFTU_LEGPA | Elongation factor Tu OS=Legionella pneumophila (strain Paris) GN=tuf1 PE=3 SV=1 | 265 | 589 | 8.0E-13 |
sp|B6YQ04|EFTU_AZOPC | Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-13 |
sp|A4IW92|EFTU_FRATW | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-13 |
sp|Q0BKB8|EFTU_FRATO | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-13 |
sp|A0Q874|EFTU_FRATN | Elongation factor Tu OS=Francisella tularensis subsp. novicida (strain U112) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-13 |
sp|B2SFC9|EFTU_FRATM | Elongation factor Tu OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-13 |
sp|Q2A1M0|EFTU_FRATH | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-13 |
sp|A7NEC7|EFTU_FRATF | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-13 |
sp|P17506|EF1A1_XENLA | Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 | 177 | 593 | 1.0E-12 |
sp|A7HM54|EFTU_FERNB | Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-12 |
sp|P26751|EF1A_PYRWO | Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 | 164 | 569 | 1.0E-12 |
sp|Q5NID9|EFTU_FRATT | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-12 |
sp|Q14JU2|EFTU_FRAT1 | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-12 |
sp|P0CY35|EF1A1_CANAL | Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 | 176 | 589 | 1.0E-12 |
sp|P50068|EFTU_UREPA | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 | 265 | 586 | 1.0E-12 |
sp|B1AJG3|EFTU_UREP2 | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 | 265 | 586 | 1.0E-12 |
sp|A6GYU7|EFTU_FLAPJ | Elongation factor Tu OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tuf PE=3 SV=1 | 176 | 589 | 1.0E-12 |
sp|Q5JFZ4|EF1A_THEKO | Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 | 177 | 559 | 1.0E-12 |
sp|P84316|EF1A_HELZE | Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84315|EF1A_HELVI | Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84318|EF1A_HELGL | Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84320|EF1A_HELDI | Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84317|EF1A_HELAM | Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84319|EF1A_HELAL | Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84322|EF1A_ANIIF | Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|P84321|EF1A_ADIBE | Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 | 182 | 556 | 1.0E-12 |
sp|A0PXT1|EFTU_CLONN | Elongation factor Tu OS=Clostridium novyi (strain NT) GN=tuf1 PE=3 SV=1 | 233 | 589 | 1.0E-12 |
sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-12 |
sp|Q8U152|EF1A_PYRFU | Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 | 165 | 569 | 2.0E-12 |
sp|O21245|EFTU_RECAM | Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 | 177 | 589 | 2.0E-12 |
sp|Q1MPT8|EFTU_LAWIP | Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-12 |
sp|A5CCA0|EFTU1_ORITB | Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 | 176 | 589 | 2.0E-12 |
sp|B1VET1|EFTU_CORU7 | Elongation factor Tu OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-12 |
sp|C6C171|EFTU_DESAD | Elongation factor Tu OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-12 |
sp|Q0AF46|EFTU2_NITEC | Elongation factor Tu 2 OS=Nitrosomonas eutropha (strain C91) GN=tuf2 PE=3 SV=1 | 265 | 586 | 2.0E-12 |
sp|Q0AIJ7|EFTU1_NITEC | Elongation factor Tu 1 OS=Nitrosomonas eutropha (strain C91) GN=tuf1 PE=3 SV=1 | 265 | 586 | 2.0E-12 |
sp|Q3SSW8|EFTU_NITWN | Elongation factor Tu OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-12 |
sp|P42439|EFTU_CORGL | Elongation factor Tu OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-12 |
sp|A4QBH0|EFTU_CORGB | Elongation factor Tu OS=Corynebacterium glutamicum (strain R) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-12 |
sp|Q7VJ74|EFTU_HELHP | Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-12 |
sp|Q5GWR8|EFTU_XANOR | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 | 177 | 589 | 3.0E-12 |
sp|Q2NZX1|EFTU_XANOM | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 | 177 | 589 | 3.0E-12 |
sp|C5A5P4|EF1A_THEGJ | Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 | 177 | 559 | 3.0E-12 |
sp|A7HWP7|EFTU_PARL1 | Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 | 176 | 589 | 3.0E-12 |
sp|A2SLF9|EFTU_METPP | Elongation factor Tu OS=Methylibium petroleiphilum (strain PM1) GN=tuf1 PE=3 SV=1 | 233 | 589 | 3.0E-12 |
sp|Q30X13|EFTU_DESAG | Elongation factor Tu OS=Desulfovibrio alaskensis (strain G20) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-12 |
sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 177 | 589 | 3.0E-12 |
sp|P17197|EF1A_THECE | Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 | 176 | 589 | 3.0E-12 |
sp|O50293|EFTU_AQUPY | Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 | 164 | 589 | 3.0E-12 |
sp|Q7VA05|EFTU_PROMA | Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 | 237 | 589 | 4.0E-12 |
sp|Q6MDN0|EFTU_PARUW | Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 | 177 | 589 | 4.0E-12 |
sp|Q8DI42|EFTU_THEEB | Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1 | 177 | 589 | 4.0E-12 |
sp|P13927|EFTU_MYCGE | Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 | 265 | 586 | 4.0E-12 |
sp|O66429|EFTU_AQUAE | Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 | 164 | 589 | 4.0E-12 |
sp|Q5QWA3|EFTU_IDILO | Elongation factor Tu OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tuf1 PE=3 SV=1 | 177 | 589 | 4.0E-12 |
sp|B5ZC31|EFTU_UREU1 | Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 | 265 | 586 | 4.0E-12 |
sp|Q3SLQ1|EFTU_THIDA | Elongation factor Tu OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tuf1 PE=3 SV=1 | 233 | 589 | 5.0E-12 |
sp|Q2RFP5|EFTU_MOOTA | Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-12 |
sp|B9DKV8|EFTU_STACT | Elongation factor Tu OS=Staphylococcus carnosus (strain TM300) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-12 |
sp|A5V604|EFTU_SPHWW | Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-12 |
sp|A1SNN5|EFTU_NOCSJ | Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-12 |
sp|A3M1F6|EFTU_ACIBT | Elongation factor Tu OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=tuf1 PE=3 SV=2 | 265 | 589 | 5.0E-12 |
sp|B7H1K5|EFTU_ACIB3 | Elongation factor Tu OS=Acinetobacter baumannii (strain AB307-0294) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-12 |
sp|A7I3U7|EFTU_CAMHC | Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-12 |
sp|A8EW02|EFTU_ARCB4 | Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-12 |
sp|Q6A6L7|EFTU_PROAC | Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 | 265 | 515 | 6.0E-12 |
sp|Q7VRP0|EFTU_BLOFL | Elongation factor Tu OS=Blochmannia floridanus GN=tuf PE=3 SV=1 | 265 | 586 | 6.0E-12 |
sp|Q118Z2|EFTU_TRIEI | Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1 | 176 | 589 | 6.0E-12 |
sp|P42477|EFTU_HERAU | Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 | 177 | 589 | 6.0E-12 |
sp|Q3J8Q0|EFTU_NITOC | Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 | 265 | 589 | 6.0E-12 |
sp|Q1QN32|EFTU_NITHX | Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 | 177 | 589 | 7.0E-12 |
sp|Q07KJ2|EFTU_RHOP5 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 | 177 | 589 | 7.0E-12 |
sp|A6VKH7|EFTU_ACTSZ | Elongation factor Tu OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tuf1 PE=3 SV=1 | 265 | 589 | 7.0E-12 |
sp|A8F4Q9|EFTU_PSELT | Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 | 265 | 589 | 7.0E-12 |
sp|Q748X8|EFTU_GEOSL | Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 | 177 | 589 | 8.0E-12 |
sp|Q3A9R3|EFTU1_CARHZ | Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 | 265 | 589 | 8.0E-12 |
sp|A8M531|EFTU_SALAI | Elongation factor Tu OS=Salinispora arenicola (strain CNS-205) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-12 |
sp|P40911|EF1A_AJECG | Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 | 176 | 589 | 8.0E-12 |
sp|A9BCK0|EFTU_PROM4 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 | 237 | 589 | 8.0E-12 |
sp|Q2G8Y2|EFTU_NOVAD | Elongation factor Tu OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tuf PE=3 SV=1 | 176 | 589 | 8.0E-12 |
sp|Q33451|EFTU_EIMTE | Elongation factor Tu, apicoplast OS=Eimeria tenella GN=tufA PE=3 SV=1 | 265 | 576 | 8.0E-12 |
sp|A4XBP8|EFTU_SALTO | Elongation factor Tu OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-12 |
sp|Q3A9P8|EFTU2_CARHZ | Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 | 265 | 589 | 9.0E-12 |
sp|Q00251|EF1A_AURPU | Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 | 176 | 589 | 9.0E-12 |
sp|A7GZK6|EFTU_CAMC5 | Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-12 |
sp|C4K4F8|EFTU_HAMD5 | Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 | 235 | 586 | 9.0E-12 |
sp|B0SUQ7|EFTU1_CAUSK | Elongation factor Tu 1 OS=Caulobacter sp. (strain K31) GN=tuf1 PE=3 SV=1 | 235 | 589 | 9.0E-12 |
sp|B6YVG2|EF1A_THEON | Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-12 |
sp|B8DLL9|EFTU_DESVM | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-12 |
sp|Q81ZS3|EFTU_NITEU | Elongation factor Tu OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tuf1 PE=3 SV=1 | 265 | 589 | 9.0E-12 |
sp|A1AVJ8|EFTU1_RUTMC | Elongation factor Tu 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf1 PE=3 SV=1 | 176 | 589 | 9.0E-12 |
sp|A1ALS6|EFTU_PELPD | Elongation factor Tu OS=Pelobacter propionicus (strain DSM 2379) GN=tuf1 PE=3 SV=1 | 177 | 589 | 1.0E-11 |
sp|A5CCL4|EFTU2_ORITB | Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 | 265 | 589 | 1.0E-11 |
sp|A5GIP0|EFTU_SYNPW | Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-11 |
sp|P42480|EFTU_HYMOC | Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-11 |
sp|Q15NP2|EFTU_PSEA6 | Elongation factor Tu OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-11 |
sp|A8HTW6|EFTU_AZOC5 | Elongation factor Tu OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=tuf1 PE=3 SV=1 | 177 | 589 | 1.0E-11 |
sp|Q8FS84|EFTU_COREF | Elongation factor Tu OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-11 |
sp|C4Z2R9|EFTU_EUBE2 | Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-11 |
sp|B9L7I8|EFTU_NAUPA | Elongation factor Tu OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-11 |
sp|Q2EEV7|EFTU_HELSJ | Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 | 176 | 589 | 1.0E-11 |
sp|A1VAK4|EFTU_DESVV | Elongation factor Tu OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-11 |
sp|Q727D5|EFTU_DESVH | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-11 |
sp|A2C4U5|EFTU_PROM1 | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-11 |
sp|A0T100|EFTU_THAPS | Elongation factor Tu, chloroplastic OS=Thalassiosira pseudonana GN=tufA PE=3 SV=1 | 265 | 589 | 2.0E-11 |
sp|P42476|EFTU_TERFE | Elongation factor Tu OS=Terrimonas ferruginea GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-11 |
sp|Q46IW4|EFTU_PROMT | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-11 |
sp|B2UQY9|EFTU_AKKM8 | Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-11 |
sp|Q0AUG3|EFTU2_SYNWW | Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 | 265 | 589 | 2.0E-11 |
sp|A5CW32|EFTU_VESOH | Elongation factor Tu OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-11 |
sp|A5GAW4|EFTU_GEOUR | Elongation factor Tu OS=Geobacter uraniireducens (strain Rf4) GN=tuf1 PE=3 SV=1 | 177 | 589 | 2.0E-11 |
sp|Q8PC51|EFTU2_XANCP | Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 | 173 | 589 | 2.0E-11 |
sp|Q4URD7|EFTU1_XANC8 | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 | 173 | 589 | 2.0E-11 |
sp|B7K834|EFTU_CYAP7 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1 | 176 | 589 | 2.0E-11 |
sp|C4LL63|EFTU_CORK4 | Elongation factor Tu OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-11 |
sp|Q0BUQ2|EFTU_GRABC | Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-11 |
sp|A5DN78|EFTU_PICGU | Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 | 265 | 516 | 2.0E-11 |
sp|B0RU96|EFTU2_XANCB | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 | 173 | 589 | 2.0E-11 |
sp|Q4URC5|EFTU2_XANC8 | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 | 173 | 589 | 2.0E-11 |
sp|Q8PC59|EFTU1_XANCP | Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 | 173 | 589 | 2.0E-11 |
sp|B0RU84|EFTU1_XANCB | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf1 PE=3 SV=1 | 173 | 589 | 2.0E-11 |
sp|Q2IXR2|EFTU_RHOP2 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|Q211E6|EFTU_RHOPB | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|Q6N4Q4|EFTU_RHOPA | Elongation factor Tu OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tuf1 PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|Q2YAZ9|EFTU_NITMU | Elongation factor Tu OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tuf1 PE=3 SV=1 | 233 | 589 | 3.0E-11 |
sp|P42471|EFTU_BRELN | Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-11 |
sp|Q4JT41|EFTU_CORJK | Elongation factor Tu OS=Corynebacterium jeikeium (strain K411) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-11 |
sp|Q89J82|EFTU_BRADU | Elongation factor Tu OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tuf PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|Q48D34|EFTU_PSE14 | Elongation factor Tu OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tuf PE=3 SV=1 | 164 | 589 | 3.0E-11 |
sp|P32186|EF1A_PUCGR | Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 | 176 | 576 | 3.0E-11 |
sp|Q250N4|EFTU_DESHY | Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-11 |
sp|B8G1W4|EFTU_DESHD | Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-11 |
sp|Q3BWY6|EFTU_XANC5 | Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|Q8NL22|EFTU_XANAC | Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|A1AX82|EFTU2_RUTMC | Elongation factor Tu 2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf2 PE=3 SV=1 | 176 | 589 | 3.0E-11 |
sp|Q0AUH8|EFTU1_SYNWW | Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 | 265 | 589 | 3.0E-11 |
sp|Q9TJQ8|EFTU_PROWI | Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 | 177 | 589 | 3.0E-11 |
sp|B0UV21|EFTU_HISS2 | Elongation factor Tu OS=Histophilus somni (strain 2336) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-11 |
sp|Q0I1U9|EFTU_HAES1 | Elongation factor Tu OS=Haemophilus somnus (strain 129Pt) GN=tuf1 PE=3 SV=1 | 265 | 589 | 4.0E-11 |
sp|Q3B6G3|EFTU_CHLL7 | Elongation factor Tu OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-11 |
sp|Q9ZT91|EFTM_ARATH | Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 | 108 | 589 | 4.0E-11 |
sp|Q134S7|EFTU1_RHOPS | Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 | 177 | 589 | 4.0E-11 |
sp|Q6AP86|EFTU1_DESPS | Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 | 177 | 589 | 4.0E-11 |
sp|A5WGK9|EFTU1_PSYWF | Elongation factor Tu 1 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf1 PE=3 SV=1 | 235 | 589 | 5.0E-11 |
sp|A6LE88|EFTU_PARD8 | Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-11 |
sp|Q1AU14|EFTU_RUBXD | Elongation factor Tu OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=tuf1 PE=3 SV=1 | 265 | 589 | 5.0E-11 |
sp|Q889X3|EFTU_PSESM | Elongation factor Tu OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tuf PE=3 SV=1 | 177 | 589 | 5.0E-11 |
sp|Q123F6|EFTU_POLSJ | Elongation factor Tu OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tuf1 PE=3 SV=1 | 223 | 589 | 6.0E-11 |
sp|P09953|EFTU_MICLU | Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-11 |
sp|A5WH42|EFTU2_PSYWF | Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 | 235 | 589 | 6.0E-11 |
sp|A0QS98|EFTU_MYCS2 | Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 | 265 | 589 | 6.0E-11 |
sp|Q5YPG4|EFTU_NOCFA | Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 | 265 | 589 | 6.0E-11 |
sp|B0T2B5|EFTU2_CAUSK | Elongation factor Tu 2 OS=Caulobacter sp. (strain K31) GN=tuf2 PE=3 SV=1 | 235 | 589 | 6.0E-11 |
sp|Q134R0|EFTU2_RHOPS | Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 | 177 | 589 | 7.0E-11 |
sp|B8J1A0|EFTU_DESDA | Elongation factor Tu OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=tuf PE=3 SV=1 | 265 | 589 | 7.0E-11 |
sp|P29542|EFTU1_STRRA | Elongation factor Tu-1 OS=Streptomyces ramocissimus GN=tuf1 PE=3 SV=1 | 265 | 589 | 7.0E-11 |
sp|A4YSJ0|EFTU_BRASO | Elongation factor Tu OS=Bradyrhizobium sp. (strain ORS278) GN=tuf PE=3 SV=1 | 177 | 589 | 7.0E-11 |
sp|A5ELM9|EFTU_BRASB | Elongation factor Tu OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tuf PE=3 SV=1 | 177 | 589 | 7.0E-11 |
sp|B6JET1|EFTU_OLICO | Elongation factor Tu OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=tuf PE=3 SV=1 | 177 | 589 | 7.0E-11 |
sp|Q6FF97|EFTU_ACIAD | Elongation factor Tu OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tuf1 PE=3 SV=1 | 265 | 589 | 7.0E-11 |
sp|Q9P9Q9|EFTU_XYLFA | Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 | 265 | 589 | 7.0E-11 |
sp|Q8D240|EFTU_WIGBR | Elongation factor Tu OS=Wigglesworthia glossinidia brevipalpis GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-11 |
sp|Q65QG6|EFTU_MANSM | Elongation factor Tu OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tuf1 PE=3 SV=1 | 265 | 589 | 8.0E-11 |
sp|Q839G8|EFTU_ENTFA | Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-11 |
sp|Q605B0|EFTU_METCA | Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 | 177 | 589 | 8.0E-11 |
sp|Q17VM8|EFTU_HELAH | Elongation factor Tu OS=Helicobacter acinonychis (strain Sheeba) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-11 |
sp|Q49V58|EFTU_STAS1 | Elongation factor Tu OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tuf PE=3 SV=1 | 265 | 586 | 9.0E-11 |
sp|Q492B2|EFTU_BLOPB | Elongation factor Tu OS=Blochmannia pennsylvanicus (strain BPEN) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-11 |
sp|A8G708|EFTU_PROM2 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 | 237 | 589 | 1.0E-10 |
sp|Q1H4Q1|EFTU1_METFK | Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 | 235 | 589 | 1.0E-10 |
sp|A2BYN4|EFTU_PROM5 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 | 237 | 589 | 1.0E-10 |
sp|A5D5I8|EFTU2_PELTS | Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|A5D5K0|EFTU1_PELTS | Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|Q1H4N9|EFTU2_METFK | Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|A3PEZ7|EFTU_PROM0 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 | 237 | 589 | 1.0E-10 |
sp|Q05FI3|EFTU_CARRP | Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 | 173 | 586 | 1.0E-10 |
sp|Q877P8|EFTU_XYLFT | Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 | 265 | 589 | 1.0E-10 |
sp|Q2W2H3|EFTU_MAGSA | Elongation factor Tu OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tuf1 PE=3 SV=1 | 177 | 589 | 1.0E-10 |
sp|Q6CZW6|EFTU_PECAS | Elongation factor Tu OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|Q1Q8P2|EFTU_PSYCK | Elongation factor Tu OS=Psychrobacter cryohalolentis (strain K5) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|Q6NJD5|EFTU_CORDI | Elongation factor Tu OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|A6LPP6|EFTU_CLOB8 | Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-10 |
sp|A2CC87|EFTU_PROM3 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-10 |
sp|B1WQY4|EFTU_CYAA5 | Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-10 |
sp|Q7V500|EFTU_PROMM | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-10 |
sp|Q8R7T8|EFTU2_CALS4 | Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 | 233 | 589 | 2.0E-10 |
sp|A2BT83|EFTU_PROMS | Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 | 248 | 589 | 2.0E-10 |
sp|Q9Z9L6|EFTU_BACHD | Elongation factor Tu OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-10 |
sp|Q4ZMP2|EFTU_PSEU2 | Elongation factor Tu OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tuf PE=3 SV=1 | 164 | 589 | 2.0E-10 |
sp|Q8R7V2|EFTU1_CALS4 | Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 | 233 | 589 | 2.0E-10 |
sp|Q5P334|EFTU_AROAE | Elongation factor Tu OS=Aromatoleum aromaticum (strain EbN1) GN=tuf1 PE=3 SV=1 | 233 | 589 | 2.0E-10 |
sp|A4SCQ7|EFTU_CHLPM | Elongation factor Tu OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-10 |
sp|Q7TTF9|EFTU_HAEDU | Elongation factor Tu OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tufA PE=3 SV=3 | 265 | 589 | 2.0E-10 |
sp|Q318N5|EFTU_PROM9 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 | 237 | 589 | 2.0E-10 |
sp|P50373|EFTU_CYCME | Elongation factor Tu, chloroplastic OS=Cyclotella meneghiniana GN=tufA PE=3 SV=1 | 176 | 589 | 2.0E-10 |
sp|C3PKP2|EFTU_CORA7 | Elongation factor Tu OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-10 |
sp|Q82DQ0|EFTU1_STRAW | Elongation factor Tu 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-10 |
sp|Q0I0B9|EFTU1_SHESR | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|Q0HNV1|EFTU1_SHESM | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|P23568|EFTU_MYCPN | Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 | 265 | 589 | 3.0E-10 |
sp|A1KB29|EFTU_AZOSB | Elongation factor Tu OS=Azoarcus sp. (strain BH72) GN=tuf1 PE=3 SV=1 | 233 | 589 | 3.0E-10 |
sp|A5EX84|EFTU_DICNV | Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|C4ZB99|EFTU_EUBR3 | Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|P51287|EFTU_PORPU | Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 | 235 | 589 | 3.0E-10 |
sp|Q4L3K9|EFTU_STAHJ | Elongation factor Tu OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|P43926|EFTU_HAEIN | Elongation factor Tu OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tufA PE=3 SV=2 | 265 | 589 | 3.0E-10 |
sp|A5UHC1|EFTU_HAEIG | Elongation factor Tu OS=Haemophilus influenzae (strain PittGG) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|A5U9R1|EFTU_HAEIE | Elongation factor Tu OS=Haemophilus influenzae (strain PittEE) GN=tuf1 PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|Q4QMT5|EFTU2_HAEI8 | Elongation factor Tu 2 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf2 PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|Q99QM0|EFTU_CAUCR | Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 | 177 | 589 | 3.0E-10 |
sp|Q2N9A8|EFTU_ERYLH | Elongation factor Tu OS=Erythrobacter litoralis (strain HTCC2594) GN=tuf PE=3 SV=1 | 176 | 589 | 3.0E-10 |
sp|A6W5T5|EFTU_KINRD | Elongation factor Tu OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|Q7UZY7|EFTU_PROMP | Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 | 265 | 589 | 3.0E-10 |
sp|Q2JMX7|EFTU_SYNJB | Elongation factor Tu OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=tuf PE=3 SV=1 | 265 | 589 | 4.0E-10 |
sp|Q01698|EFTU_THEAQ | Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 | 265 | 589 | 4.0E-10 |
sp|P57939|EFTU1_PASMU | Elongation factor Tu-A OS=Pasteurella multocida (strain Pm70) GN=tufA PE=3 SV=1 | 265 | 589 | 4.0E-10 |
sp|A1VIP8|EFTU_POLNA | Elongation factor Tu OS=Polaromonas naphthalenivorans (strain CJ2) GN=tuf1 PE=3 SV=1 | 233 | 589 | 4.0E-10 |
sp|P14081|SELB_ECOLI | Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) GN=selB PE=1 SV=3 | 259 | 577 | 4.0E-10 |
sp|B1KSM7|EFTU_CLOBM | Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 | 235 | 589 | 4.0E-10 |
sp|Q4QMW6|EFTU1_HAEI8 | Elongation factor Tu 1 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf1 PE=3 SV=1 | 265 | 589 | 4.0E-10 |
sp|P02992|EFTU_YEAST | Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 | 265 | 589 | 4.0E-10 |
sp|Q3A6R2|EFTU1_PELCD | Elongation factor Tu 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tuf1 PE=3 SV=1 | 265 | 589 | 4.0E-10 |
sp|Q1XDK1|EFTU_PYRYE | Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 | 235 | 589 | 4.0E-10 |
sp|Q57918|SELB_METJA | Selenocysteine-specific elongation factor OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=selB PE=3 SV=1 | 261 | 575 | 5.0E-10 |
sp|A0KRL0|EFTU_SHESA | Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 | 265 | 589 | 5.0E-10 |
sp|Q9TLV8|EFTU_CYACA | Elongation factor Tu, chloroplastic OS=Cyanidium caldarium GN=tufA PE=3 SV=1 | 265 | 589 | 5.0E-10 |
sp|A7GJ76|EFTU_CLOBL | Elongation factor Tu OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tuf1 PE=3 SV=1 | 235 | 589 | 5.0E-10 |
sp|B1IGF6|EFTU_CLOBK | Elongation factor Tu OS=Clostridium botulinum (strain Okra / Type B1) GN=tuf1 PE=3 SV=1 | 235 | 589 | 5.0E-10 |
sp|A5I7K8|EFTU_CLOBH | Elongation factor Tu OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tuf1 PE=3 SV=1 | 235 | 589 | 5.0E-10 |
sp|A7FZ71|EFTU_CLOB1 | Elongation factor Tu OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tuf1 PE=3 SV=1 | 235 | 589 | 5.0E-10 |
sp|Q5WLR4|EFTU_BACSK | Elongation factor Tu OS=Bacillus clausii (strain KSM-K16) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-10 |
sp|Q4FQG6|EFTU_PSYA2 | Elongation factor Tu OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=tuf1 PE=3 SV=1 | 265 | 589 | 5.0E-10 |
sp|Q6AP73|EFTU2_DESPS | Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 | 176 | 589 | 5.0E-10 |
sp|Q9MUP0|EFTU_MESVI | Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1 | 177 | 589 | 5.0E-10 |
sp|P41752|EF1A_ASHGO | Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 | 176 | 576 | 5.0E-10 |
sp|Q8ETY4|EFTU_OCEIH | Elongation factor Tu OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=tuf PE=3 SV=1 | 265 | 589 | 5.0E-10 |
sp|Q9HDF6|EF1A_PIRIN | Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 | 176 | 589 | 5.0E-10 |
sp|B2J5B1|EFTU_NOSP7 | Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-10 |
sp|Q12SW1|EFTU_SHEDO | Elongation factor Tu OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-10 |
sp|A6MW28|EFTU_RHDSA | Elongation factor Tu, chloroplastic OS=Rhodomonas salina GN=tufA PE=3 SV=1 | 265 | 589 | 6.0E-10 |
sp|Q1CN86|EFTU1_YERPN | Elongation factor Tu 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tuf1 PE=3 SV=2 | 265 | 589 | 6.0E-10 |
sp|Q2JUX4|EFTU_SYNJA | Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 | 265 | 589 | 6.0E-10 |
sp|P59506|EFTU_BUCBP | Elongation factor Tu OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tuf PE=3 SV=1 | 265 | 586 | 6.0E-10 |
sp|A3DJ00|EFTU_CLOTH | Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 | 177 | 589 | 6.0E-10 |
sp|Q65PA9|EFTU_BACLD | Elongation factor Tu OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tuf PE=3 SV=1 | 177 | 589 | 6.0E-10 |
sp|Q055E6|EFTU_LEPBL | Elongation factor Tu OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=tuf1 PE=3 SV=1 | 265 | 586 | 6.0E-10 |
sp|Q04PT6|EFTU_LEPBJ | Elongation factor Tu OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=tuf PE=3 SV=1 | 265 | 586 | 6.0E-10 |
sp|Q0BYB2|EFTU2_HYPNA | Elongation factor Tu 2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=tuf2 PE=3 SV=1 | 233 | 589 | 6.0E-10 |
sp|Q21SF0|EFTU1_RHOFT | Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 | 233 | 589 | 6.0E-10 |
sp|Q9XD38|EFTU_LEPIN | Elongation factor Tu OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=tuf PE=3 SV=1 | 265 | 589 | 7.0E-10 |
sp|Q72NF9|EFTU_LEPIC | Elongation factor Tu OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=tuf PE=3 SV=1 | 265 | 589 | 7.0E-10 |
sp|Q8EX18|EFTU_MYCPE | Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 | 265 | 586 | 7.0E-10 |
sp|B3WE38|EFTU_LACCB | Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 | 176 | 589 | 7.0E-10 |
sp|Q039K9|EFTU_LACC3 | Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 | 176 | 589 | 7.0E-10 |
sp|Q3A6P9|EFTU2_PELCD | Elongation factor Tu 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tuf2 PE=3 SV=1 | 265 | 589 | 8.0E-10 |
sp|P33166|EFTU_BACSU | Elongation factor Tu OS=Bacillus subtilis (strain 168) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-10 |
sp|A6Q6H4|EFTU_SULNB | Elongation factor Tu OS=Sulfurovum sp. (strain NBC37-1) GN=tuf PE=3 SV=1 | 265 | 589 | 8.0E-10 |
sp|Q72GW4|EFTU_THET2 | Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 | 265 | 589 | 8.0E-10 |
sp|Q21RV6|EFTU2_RHOFT | Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 | 233 | 589 | 8.0E-10 |
sp|P26184|EFTU_FLESI | Elongation factor Tu OS=Flexistipes sinusarabici GN=tuf PE=3 SV=1 | 177 | 589 | 8.0E-10 |
sp|B0BQZ3|EFTU_ACTPJ | Elongation factor Tu OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tuf1 PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|A3N246|EFTU_ACTP2 | Elongation factor Tu OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tuf1 PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|A0PM42|EFTU_MYCUA | Elongation factor Tu OS=Mycobacterium ulcerans (strain Agy99) GN=tuf PE=3 SV=1 | 265 | 586 | 9.0E-10 |
sp|B2HSL3|EFTU_MYCMM | Elongation factor Tu OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=tuf PE=3 SV=1 | 265 | 586 | 9.0E-10 |
sp|Q8YP63|EFTU_NOSS1 | Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 | 235 | 589 | 9.0E-10 |
sp|A5GW14|EFTU_SYNR3 | Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|P18668|EFTU_SYNP6 | Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tuf PE=3 SV=1 | 177 | 589 | 9.0E-10 |
sp|P33171|EFTU_SYNE7 | Elongation factor Tu OS=Synechococcus elongatus (strain PCC 7942) GN=tuf PE=3 SV=2 | 177 | 589 | 9.0E-10 |
sp|P9WNN1|EFTU_MYCTU | Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tuf PE=1 SV=1 | 265 | 589 | 9.0E-10 |
sp|P9WNN0|EFTU_MYCTO | Elongation factor Tu OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|A5U071|EFTU_MYCTA | Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|C1AL18|EFTU_MYCBT | Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|A1KGG5|EFTU_MYCBP | Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|P0A559|EFTU_MYCBO | Elongation factor Tu OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=tuf PE=3 SV=1 | 265 | 589 | 9.0E-10 |
sp|P60339|EFTU2_THET8 | Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 | 265 | 589 | 1.0E-09 |
sp|Q9Z9A7|EFTU_CHLPN | Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 | 177 | 515 | 1.0E-09 |
sp|P34823|EF1A2_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 | 173 | 600 | 1.0E-09 |
sp|Q255F3|EFTU_CHLFF | Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|Q7M7F1|EFTU_CHRVO | Elongation factor Tu OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|P60338|EFTU1_THETH | Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 | 265 | 589 | 1.0E-09 |
sp|Q5SHN6|EFTU1_THET8 | Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 | 265 | 589 | 1.0E-09 |
sp|P29543|EFTU2_STRRA | Elongation factor Tu-2 OS=Streptomyces ramocissimus GN=tuf2 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|P0CD71|EFTU_CHLTR | Elongation factor Tu OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-09 |
sp|Q3KM40|EFTU_CHLTA | Elongation factor Tu OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-09 |
sp|P40174|EFTU1_STRCO | Elongation factor Tu-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|A4TS36|EFTU2_YERPP | Elongation factor Tu 2 OS=Yersinia pestis (strain Pestoides F) GN=tuf2 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|Q8ZAN8|EFTU2_YERPE | Elongation factor Tu-B OS=Yersinia pestis GN=tufB PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|Q1C1T4|EFTU2_YERPA | Elongation factor Tu 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tuf2 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|Q66FQ9|EFTU1_YERPS | Elongation factor Tu 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|A7FNJ0|EFTU1_YERP3 | Elongation factor Tu 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|Q9PK73|EFTU_CHLMU | Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 | 177 | 589 | 1.0E-09 |
sp|Q0VSL7|EFTU_ALCBS | Elongation factor Tu OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tuf1 PE=3 SV=1 | 265 | 589 | 1.0E-09 |
sp|A9KRZ4|EFTU_CLOPH | Elongation factor Tu OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tuf PE=3 SV=1 | 177 | 589 | 1.0E-09 |
sp|B4RYQ8|EFTU_ALTMD | Elongation factor Tu OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|P74227|EFTU_SYNY3 | Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 | 164 | 589 | 2.0E-09 |
sp|P33169|EFTU_SHEPU | Elongation factor Tu OS=Shewanella putrefaciens GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|A4YBY5|EFTU_SHEPC | Elongation factor Tu OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|Q826Z7|EFTU2_STRAW | Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 | 177 | 589 | 2.0E-09 |
sp|A4SHU2|EFTU_AERS4 | Elongation factor Tu OS=Aeromonas salmonicida (strain A449) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|A1JS52|EFTU2_YERE8 | Elongation factor Tu 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tuf2 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|A3Q980|EFTU2_SHELP | Elongation factor Tu 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf2 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|P49462|EFTU_ODOSI | Elongation factor Tu, chloroplastic OS=Odontella sinensis GN=tufA PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|A8GKK1|EFTU2_SERP5 | Elongation factor Tu 2 OS=Serratia proteamaculans (strain 568) GN=tuf2 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|P42474|EFTU_CELLY | Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|Q3MDM5|EFTU_ANAVT | Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 | 235 | 589 | 2.0E-09 |
sp|Q822I4|EFTU_CHLCV | Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 | 265 | 589 | 2.0E-09 |
sp|Q83NT9|EFTU_TROW8 | Elongation factor Tu OS=Tropheryma whipplei (strain TW08/27) GN=tuf PE=3 SV=1 | 265 | 586 | 2.0E-09 |
sp|Q03QN5|EFTU_LACBA | Elongation factor Tu OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=tuf PE=3 SV=1 | 176 | 589 | 2.0E-09 |
sp|A8G8E0|EFTU1_SERP5 | Elongation factor Tu 1 OS=Serratia proteamaculans (strain 568) GN=tuf1 PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|Q0C1F4|EFTU1_HYPNA | Elongation factor Tu 1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=tuf1 PE=3 SV=1 | 233 | 589 | 2.0E-09 |
sp|Q3AMT6|EFTU_SYNSC | Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|Q2KHZ2|HBS1L_BOVIN | HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 | 177 | 540 | 2.0E-09 |
sp|Q6ACZ0|EFTU_LEIXX | Elongation factor Tu OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|Q83GW1|EFTU_TROWT | Elongation factor Tu OS=Tropheryma whipplei (strain Twist) GN=tuf PE=3 SV=1 | 265 | 586 | 2.0E-09 |
sp|B1HMZ0|EFTU_LYSSC | Elongation factor Tu OS=Lysinibacillus sphaericus (strain C3-41) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|Q74MI6|EF1A_NANEQ | Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 | 165 | 589 | 2.0E-09 |
sp|Q4FLK5|EFTU_PELUB | Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 | 265 | 589 | 2.0E-09 |
sp|O31298|EFTU_BUCAP | Elongation factor Tu OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tuf PE=3 SV=2 | 265 | 589 | 2.0E-09 |
sp|A8F982|EFTU_BACP2 | Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 | 177 | 589 | 2.0E-09 |
sp|A7Z0N5|EFTU_BACMF | Elongation factor Tu OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tuf PE=3 SV=1 | 176 | 589 | 3.0E-09 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005525 | GTP binding | Yes |
GO:0003924 | GTPase activity | Yes |
GO:0017111 | nucleoside-triphosphatase activity | No |
GO:0005488 | binding | No |
GO:0016787 | hydrolase activity | No |
GO:0003674 | molecular_function | No |
GO:0035639 | purine ribonucleoside triphosphate binding | No |
GO:0000166 | nucleotide binding | No |
GO:0043167 | ion binding | No |
GO:0019001 | guanyl nucleotide binding | No |
GO:0032553 | ribonucleotide binding | No |
GO:0097367 | carbohydrate derivative binding | No |
GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
GO:0043168 | anion binding | No |
GO:0003824 | catalytic activity | No |
GO:0017076 | purine nucleotide binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:1901265 | nucleoside phosphate binding | No |
GO:0032555 | purine ribonucleotide binding | No |
GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0036094 | small molecule binding | No |
GO:0016462 | pyrophosphatase activity | No |
GO:0032561 | guanyl ribonucleotide binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|4160 MASKTKRAQPHDRRKGESALSEFAEYVEQQQKLRFPCSKGAGHHEELDELFDSLELADTAPRIPLRSLLLDDDKH HHLKELLGERIQEGMGETVFDVGHQDNGECMQLSRQLWQKAHEAVVSAAKSIQADCELLLTHNVGGEVEADSAKA AKETGSSSKLLIRRMPQSVEHVIETRIAVVGNVDAGKSSMLGVLVKGDLDDGRGKARVSLFRHKHEVETGRTSSV GMEILGFDTKGRTVTSDTPGRKLSWEDIGKRSAKVITFSDLAGHEKYLRTTVFGLLSSSPNYCLLMVAANNGLVG MSREHLGIALALNVPIMVVVTKMDICPPNILAQTMQQITAIMRSPGARKVPTLITTREQCIETASHFVSQRICPI FQVSNVTGDKLDLVRLFLNMLPQDGRYNAAAPFELHVNDTFSVPFVGTVVSGIVKAGVAHEGDNVFVGPDALGQF LPTTVRSIERKRIRVAAASAGQSASFALKKVKRREVRKGMVVLPRSEGQAPPRVHREFVAEVLILSHATTIKTKY QAMLHVGPVSQTCAIIDIDRELIRTGDRALVAFRFVQRPEYLAPGDRLLFREGRTKGLGIVKSLGYQADEPLAAR ANPGGQ* |
Coding | >OphauB2|4160 ATGGCAAGCAAGACGAAACGAGCGCAACCGCACGACAGACGCAAAGGAGAGTCGGCCCTCAGCGAATTTGCAGAA TATGTCGAGCAGCAGCAGAAGCTGCGCTTCCCATGCTCCAAAGGCGCGGGCCATCACGAGGAGCTGGATGAGCTG TTTGACAGTCTGGAGCTGGCGGACACTGCGCCGCGAATACCACTGAGGAGCCTGCTGCTCGACGACGACAAGCAC CACCACCTCAAGGAGCTGCTTGGAGAGCGAATACAAGAGGGCATGGGCGAGACCGTCTTTGACGTGGGCCACCAA GACAATGGCGAGTGCATGCAGCTCAGCCGGCAGCTGTGGCAAAAGGCCCACGAGGCCGTGGTGTCGGCCGCCAAG AGCATCCAGGCCGACTGCGAGCTTCTGCTGACTCACAACGTGGGCGGCGAGGTGGAGGCGGACAGTGCCAAGGCG GCCAAGGAGACGGGCAGCAGCAGCAAGCTCTTGATTCGGCGCATGCCGCAGAGCGTGGAGCATGTCATTGAGACG AGGATAGCAGTCGTGGGCAACGTGGACGCAGGCAAGAGCTCCATGCTGGGGGTGCTCGTCAAGGGCGATCTCGAC GACGGCAGAGGCAAGGCGCGCGTCAGTCTCTTCCGCCACAAGCACGAGGTTGAGACGGGGCGCACCAGCTCCGTG GGCATGGAAATCCTGGGCTTTGACACCAAGGGCCGCACCGTCACGTCGGACACGCCAGGCAGAAAGCTGTCGTGG GAGGATATTGGCAAGCGCAGCGCCAAGGTGATCACCTTTTCGGACCTGGCGGGCCACGAAAAGTACCTGCGCACC ACCGTCTTTGGGCTCCTGTCAAGCAGCCCCAACTACTGTCTGCTCATGGTGGCGGCCAACAATGGGCTTGTTGGC ATGAGCCGGGAGCACCTGGGCATCGCGCTGGCGCTCAATGTGCCCATCATGGTGGTGGTGACCAAGATGGACATT TGCCCGCCCAACATCTTGGCGCAGACAATGCAGCAAATCACGGCCATTATGCGCAGCCCCGGGGCGCGCAAGGTG CCGACGCTCATCACGACGCGGGAGCAGTGCATCGAGACGGCGTCGCACTTTGTCAGCCAGCGCATCTGCCCCATT TTCCAGGTGTCCAACGTGACGGGCGACAAGCTGGACCTGGTGCGCCTCTTTCTCAACATGCTGCCCCAGGACGGG CGCTACAACGCGGCGGCGCCCTTTGAGCTGCATGTCAACGACACCTTTTCCGTGCCCTTTGTAGGCACCGTTGTC TCGGGCATTGTCAAGGCGGGAGTGGCGCACGAGGGCGACAATGTCTTTGTCGGGCCCGACGCGCTGGGCCAGTTC TTGCCCACGACGGTTCGCTCCATTGAGCGCAAGCGCATCCGCGTTGCCGCCGCCTCGGCGGGACAGTCGGCCTCG TTTGCCCTCAAAAAGGTGAAGCGAAGAGAGGTGCGCAAGGGCATGGTGGTGCTGCCGCGCAGCGAGGGCCAGGCG CCGCCCCGGGTGCACCGCGAGTTTGTCGCCGAGGTGCTCATCTTGTCGCACGCCACCACCATCAAGACAAAGTAC CAGGCCATGCTGCACGTGGGCCCCGTGTCGCAGACGTGCGCCATTATCGACATTGACCGCGAGCTCATCCGCACC GGCGATCGCGCCTTGGTGGCCTTTCGCTTTGTCCAGCGGCCCGAGTATCTCGCTCCGGGCGATCGGCTCTTGTTC CGCGAGGGCCGCACCAAGGGCCTGGGCATTGTCAAGAGCCTTGGCTACCAGGCAGACGAGCCACTGGCGGCGCGG GCCAATCCGGGCGGCCAGTAG |
Transcript | >OphauB2|4160 ATGGCAAGCAAGACGAAACGAGCGCAACCGCACGACAGACGCAAAGGAGAGTCGGCCCTCAGCGAATTTGCAGAA TATGTCGAGCAGCAGCAGAAGCTGCGCTTCCCATGCTCCAAAGGCGCGGGCCATCACGAGGAGCTGGATGAGCTG TTTGACAGTCTGGAGCTGGCGGACACTGCGCCGCGAATACCACTGAGGAGCCTGCTGCTCGACGACGACAAGCAC CACCACCTCAAGGAGCTGCTTGGAGAGCGAATACAAGAGGGCATGGGCGAGACCGTCTTTGACGTGGGCCACCAA GACAATGGCGAGTGCATGCAGCTCAGCCGGCAGCTGTGGCAAAAGGCCCACGAGGCCGTGGTGTCGGCCGCCAAG AGCATCCAGGCCGACTGCGAGCTTCTGCTGACTCACAACGTGGGCGGCGAGGTGGAGGCGGACAGTGCCAAGGCG GCCAAGGAGACGGGCAGCAGCAGCAAGCTCTTGATTCGGCGCATGCCGCAGAGCGTGGAGCATGTCATTGAGACG AGGATAGCAGTCGTGGGCAACGTGGACGCAGGCAAGAGCTCCATGCTGGGGGTGCTCGTCAAGGGCGATCTCGAC GACGGCAGAGGCAAGGCGCGCGTCAGTCTCTTCCGCCACAAGCACGAGGTTGAGACGGGGCGCACCAGCTCCGTG GGCATGGAAATCCTGGGCTTTGACACCAAGGGCCGCACCGTCACGTCGGACACGCCAGGCAGAAAGCTGTCGTGG GAGGATATTGGCAAGCGCAGCGCCAAGGTGATCACCTTTTCGGACCTGGCGGGCCACGAAAAGTACCTGCGCACC ACCGTCTTTGGGCTCCTGTCAAGCAGCCCCAACTACTGTCTGCTCATGGTGGCGGCCAACAATGGGCTTGTTGGC ATGAGCCGGGAGCACCTGGGCATCGCGCTGGCGCTCAATGTGCCCATCATGGTGGTGGTGACCAAGATGGACATT TGCCCGCCCAACATCTTGGCGCAGACAATGCAGCAAATCACGGCCATTATGCGCAGCCCCGGGGCGCGCAAGGTG CCGACGCTCATCACGACGCGGGAGCAGTGCATCGAGACGGCGTCGCACTTTGTCAGCCAGCGCATCTGCCCCATT TTCCAGGTGTCCAACGTGACGGGCGACAAGCTGGACCTGGTGCGCCTCTTTCTCAACATGCTGCCCCAGGACGGG CGCTACAACGCGGCGGCGCCCTTTGAGCTGCATGTCAACGACACCTTTTCCGTGCCCTTTGTAGGCACCGTTGTC TCGGGCATTGTCAAGGCGGGAGTGGCGCACGAGGGCGACAATGTCTTTGTCGGGCCCGACGCGCTGGGCCAGTTC TTGCCCACGACGGTTCGCTCCATTGAGCGCAAGCGCATCCGCGTTGCCGCCGCCTCGGCGGGACAGTCGGCCTCG TTTGCCCTCAAAAAGGTGAAGCGAAGAGAGGTGCGCAAGGGCATGGTGGTGCTGCCGCGCAGCGAGGGCCAGGCG CCGCCCCGGGTGCACCGCGAGTTTGTCGCCGAGGTGCTCATCTTGTCGCACGCCACCACCATCAAGACAAAGTAC CAGGCCATGCTGCACGTGGGCCCCGTGTCGCAGACGTGCGCCATTATCGACATTGACCGCGAGCTCATCCGCACC GGCGATCGCGCCTTGGTGGCCTTTCGCTTTGTCCAGCGGCCCGAGTATCTCGCTCCGGGCGATCGGCTCTTGTTC CGCGAGGGCCGCACCAAGGGCCTGGGCATTGTCAAGAGCCTTGGCTACCAGGCAGACGAGCCACTGGCGGCGCGG GCCAATCCGGGCGGCCAGTAG |
Gene | >OphauB2|4160 ATGGCAAGCAAGACGAAACGAGCGCAACCGCACGACAGACGCAAAGGAGAGTCGGTATGTTGCGGCCAAGGTGAC AAGACTGCGCGCTGAGTCTCACGAGCACAGGCCCTCAGCGAATTTGCAGAATATGTCGAGCAGCAGCAGAAGCTG CGCTTCCCATGCTCCAAAGGCGCGGGCCATCACGAGGAGCTGGATGAGCTGTTTGACAGTCTGGAGCTGGCGGAC ACTGCGCCGCGAATACCACTGAGGAGCCTGCTGCTCGACGACGACAAGCACCACCACCTCAAGGAGCTGCTTGGA GAGCGAATACAAGAGGGCATGGGCGAGACCGTCTTTGACGTGGGCCACCAAGACAATGGCGAGTGCATGCAGCTC AGCCGGCAGCTGTGGCAAAAGGCCCACGAGGCCGTGGTGTCGGCCGCCAAGAGCATCCAGGCCGACTGCGAGCTT CTGCTGACTCACAACGTGGGCGGCGAGGTGGAGGCGGACAGTGCCAAGGCGGCCAAGGAGACGGGCAGCAGCAGC AAGCTCTTGATTCGGCGCATGCCGCAGAGCGTGGAGCATGTCATTGAGACGAGGATAGCAGTCGTGGGCAACGGT AAGCGGCTGCAAGCACCGTTGCAAGCGTGGCTGACGCGGCAGCAGTGGACGCAGGCAAGAGCTCCATGCTGGGGG TGCTCGTCAAGGGCGATCTCGACGACGGCAGAGGCAAGGCGCGCGTCAGTCTCTTCCGCCACAAGCACGAGGTTG AGACGGGGCGCACCAGCTCCGTGGGCATGGAAATCCTGGGCTTTGACACCAAGGGCCGCACCGTCACGTCGGACA CGCCAGGCAGTGTGTGGCCCCGTCCCATTTGATGCTCATGGCTGACAGACGGCAAAAGGAAAGCTGTCGTGGGAG GATATTGGCAAGCGCAGCGCCAAGGTGATCACCTTTTCGGACCTGGCGGGCCACGAAAAGTACCTGCGCACCACC GTCTTTGGGCTCCTGTCAAGCAGCCCCAACTACTGTCTGCTCATGGTGGCGGCCAACAATGGGCTTGTTGGCATG AGCCGGGAGCACCTGGGCATCGCGCTGGCGCTCAATGTGCCCATCATGGTGGTGGTGACCAAGATGGACATTTGC CCGCCCAACATCTTGGCGCAGACAATGCAGCAAATCACGGCCATTATGCGCAGCCCCGGGGCGCGCAAGGTGCCG ACGCTCATCACGACGCGGGAGCAGTGCATCGAGACGGCGTCGCACTTTGTCAGCCAGCGCATCTGCCCCATTTTC CAGGTGTCCAACGTGACGGGCGACAAGCTGGACCTGGTGCGCCTCTTTCTCAACATGCTGCCCCAGGACGGGCGC TACAACGCGGCGGCGCCCTTTGAGCTGCATGTCAACGACACCTTTTCCGTGCCCTTTGTAGGCACCGTTGTCTCG GGCATTGTCAAGGCGGGAGTGGCGCACGAGGGCGACAATGTCTTTGTCGGGCCCGACGCGCTGGGCCAGTTCTTG CCCACGACGGTTCGCTCCATTGAGCGCAAGCGCATCCGCGTTGCCGCCGCCTCGGCGGGACAGTCGGCCTCGTTT GCCCTCAAAAAGGTGAAGCGAAGAGAGGTGCGCAAGGGCATGGTGGTGCTGCCGCGCAGCGAGGGCCAGGCGCCG CCCCGGGTGCACCGCGAGTTTGTCGCCGAGGTGCTCATCTTGTCGCACGCCACCACCATCAAGACAAAGTACCAG GCCATGCTGCACGTGGGCCCCGTGTCGCAGACGTGCGCCATTATCGACATTGACCGCGAGCTCATCCGCACCGGC GATCGCGCCTTGGTGGCCTTTCGCTTTGTCCAGCGGCCCGAGTATCTCGCTCCGGGCGATCGGCTCTTGTTCCGC GAGGGCCGCACCAAGGGCCTGGGCATTGTCAAGAGCCTTGGCTACCAGGCAGACGAGCCACTGGCGGCGCGGGCC AATCCGGGCGGCCAGTAG |