Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4156
Gene name
LocationContig_271:6276..7877
Strand-
Gene length (bp)1601
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 8.0E-22 100 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 80 481 7.0E-46
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 44 353 2.0E-35
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 125 272 8.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 94 264 4.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 99 265 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 80 481 7.0E-46
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 44 353 2.0E-35
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 125 272 8.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 94 264 4.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 99 265 8.0E-09
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 166 266 2.0E-08
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 100 264 7.0E-08
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 100 264 4.0E-07
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 165 250 9.0E-07
sp|Q0JQ12|CKX1_ORYSJ Cytokinin dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CKX1 PE=3 SV=2 97 264 1.0E-06
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 169 264 1.0E-06
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 169 264 1.0E-06
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 74 303 2.0E-06
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 85 264 2.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 85 264 2.0E-06
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 100 264 3.0E-06
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 100 264 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4156
MYFFFFYLLLFVFCHGAMASELVSAIPFDTSLPEHHLREASLLRLSSDVEAVCSILHSTYPNLLVWDPLGPHGLK
TINRTVDFEEASANYLSAESAARLPACIFFPANAQQVSSAVMVLNAHPTVRFGLKSGGHNPNPEFSTASGGLLIS
FRLNSCSVVPNANDQSVLVGAGCKWKDVYSALQPLGKAAVGGRFGDIGVTGFILGGGLSYLSAQYGFACDNVLSF
ECVLANGTIVTASANSHSDLYFALRGGGNQFAIVTRLKLRTWDVGYKGIVWGGVRAYAAAQQPALLAAIANFTTN
SDAHPKAALLPNFNFIGALGPVSLVFFFYDGSLPPTNVFAEFDRLPSLWNDTKQRTYENLHEDVFSGDLKQLRIV
IRENTFPNMPLSQMSSFLVKHNTALHQVAESLAESFDLRVLSCEIQPMPRTIVEASWNTGGANALSLAPEHGDRL
WIVYHLAWLQPSCDKKCPSSFQKVVESMHDLHNTNFSRIAPTNYKHGNLSIIRKVLFCISYHF*
Coding >OphauB2|4156
ATGTACTTCTTCTTCTTTTATCTGCTTTTATTCGTCTTCTGCCATGGCGCCATGGCGTCAGAATTAGTTTCTGCT
ATTCCATTTGACACTTCTCTACCAGAGCACCACTTAAGAGAAGCCTCACTTTTGCGATTGTCGTCCGACGTCGAG
GCAGTTTGCTCAATCCTACACTCAACTTACCCCAACTTACTTGTTTGGGATCCTCTTGGACCTCATGGCCTGAAA
ACAATAAATCGAACAGTAGACTTCGAGGAGGCCTCCGCTAACTACCTTAGCGCCGAAAGTGCAGCCCGCCTTCCT
GCATGCATCTTCTTTCCGGCCAACGCGCAGCAAGTTTCTTCTGCCGTCATGGTTTTGAATGCTCATCCTACTGTT
CGATTCGGCCTCAAGTCTGGTGGCCATAATCCCAATCCTGAGTTCTCGACTGCCTCTGGCGGCCTGCTTATATCT
TTTCGCTTGAACTCATGCTCAGTCGTCCCTAATGCCAACGATCAATCTGTCTTGGTCGGCGCAGGGTGTAAGTGG
AAAGATGTATATTCTGCTCTCCAGCCCCTCGGCAAGGCTGCCGTTGGGGGCCGCTTTGGAGACATAGGTGTCACT
GGTTTCATTCTTGGGGGCGGACTGTCTTACTTGTCTGCCCAATACGGCTTTGCTTGTGACAACGTATTAAGTTTT
GAATGCGTCTTGGCCAATGGTACTATTGTTACAGCAAGCGCAAACTCTCATTCAGACTTATATTTCGCTTTACGA
GGGGGCGGCAATCAATTCGCTATTGTCACCCGTCTTAAATTGCGAACTTGGGATGTTGGTTATAAAGGTATCGTC
TGGGGCGGTGTACGGGCTTATGCTGCGGCACAGCAGCCTGCTCTTCTAGCTGCTATCGCCAACTTCACCACAAAC
AGCGACGCCCACCCCAAAGCCGCTCTTCTTCCAAACTTCAACTTCATTGGAGCCCTTGGCCCCGTGTCTCTAGTC
TTTTTCTTCTATGATGGATCTCTCCCACCTACGAACGTATTTGCCGAGTTTGATCGTCTCCCTTCTTTATGGAAC
GATACCAAGCAACGTACCTACGAGAATTTACACGAAGACGTCTTCTCTGGCGACTTGAAGCAACTCCGCATTGTT
ATTCGAGAGAATACATTCCCCAACATGCCTTTATCCCAAATGTCATCGTTTCTAGTCAAGCATAACACGGCTTTG
CATCAAGTTGCGGAAAGCTTAGCCGAGTCTTTCGACCTGCGAGTCTTATCTTGCGAGATTCAGCCAATGCCACGC
ACTATTGTCGAAGCTTCTTGGAACACTGGTGGCGCTAATGCGCTGAGTCTGGCGCCAGAACACGGAGACCGTCTT
TGGATCGTTTATCATCTTGCTTGGCTGCAACCTTCATGCGATAAAAAATGTCCATCATCGTTTCAGAAAGTCGTG
GAATCGATGCATGACCTCCATAATACAAACTTCTCACGTATTGCTCCTACTAATTACAAACATGGCAACCTAAGT
ATTATAAGGAAAGTACTTTTTTGCATCTCATATCATTTCTAG
Transcript >OphauB2|4156
ATGTACTTCTTCTTCTTTTATCTGCTTTTATTCGTCTTCTGCCATGGCGCCATGGCGTCAGAATTAGTTTCTGCT
ATTCCATTTGACACTTCTCTACCAGAGCACCACTTAAGAGAAGCCTCACTTTTGCGATTGTCGTCCGACGTCGAG
GCAGTTTGCTCAATCCTACACTCAACTTACCCCAACTTACTTGTTTGGGATCCTCTTGGACCTCATGGCCTGAAA
ACAATAAATCGAACAGTAGACTTCGAGGAGGCCTCCGCTAACTACCTTAGCGCCGAAAGTGCAGCCCGCCTTCCT
GCATGCATCTTCTTTCCGGCCAACGCGCAGCAAGTTTCTTCTGCCGTCATGGTTTTGAATGCTCATCCTACTGTT
CGATTCGGCCTCAAGTCTGGTGGCCATAATCCCAATCCTGAGTTCTCGACTGCCTCTGGCGGCCTGCTTATATCT
TTTCGCTTGAACTCATGCTCAGTCGTCCCTAATGCCAACGATCAATCTGTCTTGGTCGGCGCAGGGTGTAAGTGG
AAAGATGTATATTCTGCTCTCCAGCCCCTCGGCAAGGCTGCCGTTGGGGGCCGCTTTGGAGACATAGGTGTCACT
GGTTTCATTCTTGGGGGCGGACTGTCTTACTTGTCTGCCCAATACGGCTTTGCTTGTGACAACGTATTAAGTTTT
GAATGCGTCTTGGCCAATGGTACTATTGTTACAGCAAGCGCAAACTCTCATTCAGACTTATATTTCGCTTTACGA
GGGGGCGGCAATCAATTCGCTATTGTCACCCGTCTTAAATTGCGAACTTGGGATGTTGGTTATAAAGGTATCGTC
TGGGGCGGTGTACGGGCTTATGCTGCGGCACAGCAGCCTGCTCTTCTAGCTGCTATCGCCAACTTCACCACAAAC
AGCGACGCCCACCCCAAAGCCGCTCTTCTTCCAAACTTCAACTTCATTGGAGCCCTTGGCCCCGTGTCTCTAGTC
TTTTTCTTCTATGATGGATCTCTCCCACCTACGAACGTATTTGCCGAGTTTGATCGTCTCCCTTCTTTATGGAAC
GATACCAAGCAACGTACCTACGAGAATTTACACGAAGACGTCTTCTCTGGCGACTTGAAGCAACTCCGCATTGTT
ATTCGAGAGAATACATTCCCCAACATGCCTTTATCCCAAATGTCATCGTTTCTAGTCAAGCATAACACGGCTTTG
CATCAAGTTGCGGAAAGCTTAGCCGAGTCTTTCGACCTGCGAGTCTTATCTTGCGAGATTCAGCCAATGCCACGC
ACTATTGTCGAAGCTTCTTGGAACACTGGTGGCGCTAATGCGCTGAGTCTGGCGCCAGAACACGGAGACCGTCTT
TGGATCGTTTATCATCTTGCTTGGCTGCAACCTTCATGCGATAAAAAATGTCCATCATCGTTTCAGAAAGTCGTG
GAATCGATGCATGACCTCCATAATACAAACTTCTCACGTATTGCTCCTACTAATTACAAACATGGCAACCTAAGT
ATTATAAGGAAAGTACTTTTTTGCATCTCATATCATTTCTAG
Gene >OphauB2|4156
ATGTACTTCTTCTTCTTTTATCTGCTTTTATTCGTCTTCTGCCATGGCGCCATGGCGTCAGAATTAGTTTCTGCT
ATTCCATTTGACACTTCTCTACCAGAGCACCACTTAAGAGAAGCCTCACTTTTGCGATTGTCGTCCGACGTCGAG
GCAGTTTGCTCAATCCTACACTCAACTTACCCCAACTTACTTGTTTGGGATCCTCTTGGACCTCATGGCCTGAAA
ACAATAAATCGAACAGTAGACTTCGAGGAGGCCTCCGCTAACTACCTTAGCGCCGAAAGTGCAGCCCGCCTTCCT
GCATGCATCTTCTTTCCGGCCAACGCGCAGCAAGTTTCTTCTGCCGTCATGGTTTTGAATGCTCATCCTACTGTT
CGATTCGGCCTCAAGTCTGGTGGCCATAATCCCAATCCTGAGTTCTCGACTGCCTCTGGCGGCCTGCTTATATCT
TTTCGCTTGAACTCATGCTCAGTCGTCCCTAATGCCAACGATCAATCTGTCTTGGTCGGCGCAGGGTGTAAGTGG
AAAGATGTATATTCTGCTCTCCAGCCCCTCGGCAAGGCTGCCGTTGGGGGCCGCTTTGGAGACATAGGTGTCACT
GGTTTCATTCTTGGGGGCGGACTGTCTTACTTGTCTGCCCAATACGTAAGAAATTCTATAAAAAACTTGCCTGTC
AAAATAGGCAGGCTGACAGTCATTCACAGGGCTTTGCTTGTGACAACGTATTAAGTTTTGAATGCGTCTTGGCCA
ATGGTACTATTGTTACAGCAAGCGCAAACTCTCATTCAGACTTATATTTCGCTTTACGAGGGGGCGGCAATCAAT
TCGCTATTGTCACCCGTCTTAAATTGCGAACTTGGGATGTTGGTTATAAAGGTATCGTCTGGGGCGGTGTACGGG
CTTATGCTGCGGCACAGCAGCCTGCTCTTCTAGCTGCTATCGCCAACTTCACCACAAACAGCGACGCCCACCCCA
AAGCCGCTCTTCTTCCAAACTTCAACTTCATTGGAGCCCTTGGCCCCGTGTCTCTAGTCTTTTTCTTCTATGATG
GATCTCTCCCACCTACGAACGTATTTGCCGAGTTTGATCGTCTCCCTTCTTTATGGAACGATACCAAGCAACGTA
CCTACGAGAATTTACACGAAGACGTCTTCTCTGGCGACTTGAAGCAACTCCGCATTGTTATTCGAGAGAATACAT
TCCCCAACATGCCTTTATCCCAAATGTCATCGTTTCTAGTCAAGCATAACACGGCTTTGCATCAAGTTGCGGAAA
GCTTAGCCGAGTCTTTCGACCTGCGAGTCTTATCTTGCGAGATTCAGCCAATGCCACGCACTATTGTCGAAGCTT
CTTGGAACACTGGTGGCGCTAATGCGCTGAGTCTGGCGCCAGAACACGGAGACCGTCTTTGGATCGTTTATCATC
TTGCTTGGCTGCAACCTTCATGCGATAAAAAATGTCCATCATCGTTTCAGAAAGTCGTGGAATCGATGCATGACC
TCCATAATACAAACTTCTCACGTATTGCTCCTACTAATTACAAACATGGCAACCTAAGTATTATAAGGAAAGTAC
TTTTTTGCATCTCATATCATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail