Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4151
Gene name
LocationContig_270:2107..3263
Strand+
Gene length (bp)1156
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase 2.2E-43 89 257

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09814|TGS1_SCHPO Trimethylguanosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tgs1 PE=1 SV=3 36 255 8.0E-37
sp|Q96RS0|TGS1_HUMAN Trimethylguanosine synthase OS=Homo sapiens GN=TGS1 PE=1 SV=3 36 260 8.0E-35
sp|P85107|TGS1_RAT Trimethylguanosine synthase OS=Rattus norvegicus GN=Tgs1 PE=1 SV=1 36 255 2.0E-34
sp|Q923W1|TGS1_MOUSE Trimethylguanosine synthase OS=Mus musculus GN=Tgs1 PE=1 SV=2 36 255 1.0E-33
sp|Q12052|TGS1_YEAST Trimethylguanosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGS1 PE=1 SV=1 40 228 6.0E-24

GO

GO Term Description Terminal node
GO:0009452 7-methylguanosine RNA capping Yes
GO:0001510 RNA methylation Yes
GO:0008168 methyltransferase activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043414 macromolecule methylation No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0032259 methylation No
GO:0036260 RNA capping No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0009451 RNA modification No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4151
MSSPVTNMWREAERIAPAPRLPLTSLCRHARDRSDVPDGLKRYFAQRYAIFSRYDLGIRLTNAAWYGVTPEPIAQ
QIAQDMKNSDPSKRFLIDTFAGAGGNVIAFALSGRWERVIAIERDPNTLACAQHNARLYGVDDSMISWVLGDSFH
YIDVLVNNPAQLHSNLRVDVNATVVFSSPPWGGPSYQLDKIFDLNRMEPYGLGQLHKAYKRLDHAIYLPRTSDIR
QIADLIPDTQRIRVVQYCIMRASKAMVVYFPAQETQQTSASSPATPTFASVARKALDSSPVQTLALAVTPTSTSG
QGTTRPNSSGGVLYPSKQTNPCTPHFTPVAPLRLAPRFSMLKTPAWT*
Coding >OphauB2|4151
ATGTCTTCCCCTGTTACTAATATGTGGCGAGAAGCAGAGCGTATTGCACCAGCACCTCGCCTTCCGCTGACAAGT
CTGTGTCGTCACGCTAGGGACAGGAGTGATGTTCCAGATGGATTGAAGAGATACTTTGCTCAAAGATATGCAATT
TTTTCGCGCTATGACCTTGGCATCCGTCTGACCAATGCTGCTTGGTACGGAGTCACGCCAGAGCCCATAGCACAA
CAAATTGCCCAGGACATGAAAAACAGCGACCCCAGCAAGAGATTCCTCATTGATACGTTTGCTGGGGCTGGGGGA
AACGTCATTGCCTTTGCCCTCAGTGGGCGATGGGAGCGCGTTATTGCAATCGAGCGCGACCCCAACACGCTGGCA
TGCGCGCAGCACAACGCCAGGCTCTATGGCGTCGATGACTCCATGATTTCGTGGGTCCTTGGAGACAGCTTCCAC
TATATAGACGTCCTTGTCAACAATCCCGCCCAGCTGCACTCTAACTTGCGAGTTGATGTCAATGCCACAGTGGTG
TTTAGTAGCCCACCCTGGGGCGGGCCCAGCTACCAACTCGACAAGATCTTTGATCTCAACAGAATGGAGCCCTAT
GGGCTTGGCCAGCTACACAAGGCATACAAAAGACTGGACCATGCAATCTACTTGCCCCGGACTAGCGATATTCGG
CAGATTGCGGACCTGATACCCGACACTCAGCGCATCCGCGTAGTGCAGTATTGCATAATGAGGGCAAGCAAGGCC
ATGGTGGTCTATTTCCCAGCACAGGAGACTCAGCAGACATCGGCCTCGTCGCCCGCTACACCGACTTTCGCGTCG
GTGGCCAGGAAAGCATTGGATTCGTCCCCCGTACAGACTTTGGCCTTGGCTGTCACACCCACCTCTACCTCGGGG
CAAGGGACAACACGGCCCAACTCGTCAGGCGGAGTTCTTTATCCCTCAAAGCAAACGAATCCTTGTACCCCGCAT
TTTACACCAGTGGCTCCCCTACGCCTTGCGCCAAGATTTTCCATGCTCAAGACGCCCGCATGGACTTGA
Transcript >OphauB2|4151
ATGTCTTCCCCTGTTACTAATATGTGGCGAGAAGCAGAGCGTATTGCACCAGCACCTCGCCTTCCGCTGACAAGT
CTGTGTCGTCACGCTAGGGACAGGAGTGATGTTCCAGATGGATTGAAGAGATACTTTGCTCAAAGATATGCAATT
TTTTCGCGCTATGACCTTGGCATCCGTCTGACCAATGCTGCTTGGTACGGAGTCACGCCAGAGCCCATAGCACAA
CAAATTGCCCAGGACATGAAAAACAGCGACCCCAGCAAGAGATTCCTCATTGATACGTTTGCTGGGGCTGGGGGA
AACGTCATTGCCTTTGCCCTCAGTGGGCGATGGGAGCGCGTTATTGCAATCGAGCGCGACCCCAACACGCTGGCA
TGCGCGCAGCACAACGCCAGGCTCTATGGCGTCGATGACTCCATGATTTCGTGGGTCCTTGGAGACAGCTTCCAC
TATATAGACGTCCTTGTCAACAATCCCGCCCAGCTGCACTCTAACTTGCGAGTTGATGTCAATGCCACAGTGGTG
TTTAGTAGCCCACCCTGGGGCGGGCCCAGCTACCAACTCGACAAGATCTTTGATCTCAACAGAATGGAGCCCTAT
GGGCTTGGCCAGCTACACAAGGCATACAAAAGACTGGACCATGCAATCTACTTGCCCCGGACTAGCGATATTCGG
CAGATTGCGGACCTGATACCCGACACTCAGCGCATCCGCGTAGTGCAGTATTGCATAATGAGGGCAAGCAAGGCC
ATGGTGGTCTATTTCCCAGCACAGGAGACTCAGCAGACATCGGCCTCGTCGCCCGCTACACCGACTTTCGCGTCG
GTGGCCAGGAAAGCATTGGATTCGTCCCCCGTACAGACTTTGGCCTTGGCTGTCACACCCACCTCTACCTCGGGG
CAAGGGACAACACGGCCCAACTCGTCAGGCGGAGTTCTTTATCCCTCAAAGCAAACGAATCCTTGTACCCCGCAT
TTTACACCAGTGGCTCCCCTACGCCTTGCGCCAAGATTTTCCATGCTCAAGACGCCCGCATGGACTTGA
Gene >OphauB2|4151
ATGTCTTCCCCTGTTACTAATATGTGGCGAGAAGCAGAGCGTATTGCACCAGCACCTCGCCTTCCGCTGACAAGT
CTGTGTCGTCACGCTAGGGACAGGAGTGATGTTCCAGATGGATTGAAGAGGTATGTCGCCCGGCGGCACCAATAT
CGAGTACAGCGTGACTAACAGGGCATAGATACTTTGCTCAAAGATATGCAATTTTTTCGCGCTATGACCTTGGCA
TCCGTCTGACCAATGCTGCTTGGTACGGAGTCACGCCAGAGCCCATAGCACAGTAAGTTGTTGCTTGGCCTGCCG
ACTTTGGCACAAGGGTAAAAGCTGACTTGACGACAGACAAATTGCCCAGGACATGAAAAACAGCGACCCCAGCAA
GAGATTCCTCATTGATACGTTTGCTGGGGCTGGGGGAAACGTCATTGCCTTTGCCCTCAGTGGGCGATGGGAGCG
CGTTATTGCAATCGAGCGCGACCCCAACACGCTGGCATGCGCGCAGCACAACGCCAGGCTCTATGGCGTCGATGA
CTCCATGATTTCGTGGGTCCTTGGAGACAGCTTCCACTATATAGACGTCCTTGTCAACAATCCCGCCCAGCTGCA
CTCTAACTTGCGAGTTGATGTCAATGCCACAGTGGTGTTTAGTAGCCCACCCTGGGGCGGGCCCAGCTACCAACT
CGACAAGATCTTTGATCTCAACAGAATGGAGCCCTATGGGCTTGGCCAGCTACACAAGGCATACAAAAGACTGGA
CCATGCAATCTACTTGCCCCGGACTAGCGATATTCGGCAGATTGCGGACCTGATACCCGACACTCAGCGCATCCG
CGTAGTGCAGTATTGCATAATGAGGGCAAGCAAGGCCATGGTGGTCTATTTCCCAGCACAGGAGACTCAGCAGAC
ATCGGCCTCGTCGCCCGCTACACCGACTTTCGCGTCGGTGGCCAGGAAAGCATTGGATTCGTCCCCCGTACAGAC
TTTGGCCTTGGCTGTCACACCCACCTCTACCTCGGGGCAAGGGACAACACGGCCCAACTCGTCAGGCGGAGTTCT
TTATCCCTCAAAGCAAACGAATCCTTGTACCCCGCATTTTACACCAGTGGCTCCCCTACGCCTTGCGCCAAGATT
TTCCATGCTCAAGACGCCCGCATGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail