Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4148
Gene name
LocationContig_27:171117..171946
Strand-
Gene length (bp)829
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P 8.7E-21 126 214
PF00466 Ribosomal_L10 Ribosomal protein L10 1.1E-19 18 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 238 6.0E-117
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 238 5.0E-114
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 234 1.0E-62
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 247 3.0E-56
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 1 237 7.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 238 6.0E-117
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 238 5.0E-114
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 234 1.0E-62
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 247 3.0E-56
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 1 237 7.0E-53
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 1 238 8.0E-52
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 1 234 1.0E-51
sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1 1 237 3.0E-51
sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2 1 237 2.0E-50
sp|Q86HD3|MRT4_DICDI Ribosome assembly factor mrt4 OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1 1 239 7.0E-40
sp|B6YSX9|RL10_THEON 50S ribosomal protein L10 OS=Thermococcus onnurineus (strain NA1) GN=rpl10 PE=3 SV=1 21 238 2.0E-10
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 19 227 5.0E-08
sp|Q5JH36|RL10_THEKO 50S ribosomal protein L10 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl10 PE=3 SV=1 21 240 6.0E-08
sp|Q8TX50|RL10_METKA 50S ribosomal protein L10 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl10 PE=3 SV=2 18 231 3.0E-07
sp|P13553|RL10_HALSA 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl10 PE=3 SV=1 14 228 5.0E-07
sp|B0R4W1|RL10_HALS3 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl10 PE=3 SV=1 14 228 5.0E-07
sp|P15825|RL10_HALMA 50S ribosomal protein L10 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl10 PE=1 SV=2 21 197 2.0E-06
sp|C6A1F5|RL10_THESM 50S ribosomal protein L10 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl10 PE=3 SV=1 21 238 2.0E-06
sp|C5A428|RL10_THEGJ 50S ribosomal protein L10 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl10 PE=3 SV=1 9 228 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4148
MPKSKRAKIVHLTQVSKKTRQHKDKLIDSIRDALPNYQHCLIIRVDNMRNTHLKDVRHELASDCRLFFGKTKVMA
RALGSSPSDAIAPGIELLHKHLHGSVGILLSNRSPSDLVQYFENLSKVDFARAGVTASRSFTVPPGVVYATAGEV
SVQHDVPLEHTLEPELRRLGVPTRMVKGKIVLGDENGKGTGHLVCKEGEVLDSRQTRLLKLFGVCLSEFRVQVVA
YWSASTSQVTEVDTSGMEVQDA*
Coding >OphauB2|4148
ATGCCCAAGTCGAAGCGCGCAAAAATCGTCCACCTCACCCAAGTCTCAAAAAAGACTCGCCAACACAAGGACAAG
CTCATTGATTCCATTCGCGATGCTTTGCCCAACTACCAGCACTGCCTCATCATTCGCGTGGACAACATGCGCAAC
ACGCACCTCAAAGACGTCCGCCACGAACTCGCCTCCGACTGCCGCCTCTTCTTTGGCAAGACCAAGGTCATGGCC
CGCGCACTCGGCTCCTCTCCCTCGGATGCCATTGCCCCTGGCATCGAGCTCCTGCACAAGCATCTTCACGGCTCT
GTCGGCATCCTTCTCTCCAACAGATCGCCCAGTGACCTTGTCCAATATTTCGAGAACCTGTCCAAGGTTGACTTT
GCCAGGGCTGGTGTGACAGCCTCGCGATCATTTACTGTCCCTCCTGGCGTTGTCTACGCAACTGCTGGCGAGGTT
TCAGTCCAACACGACGTGCCCCTCGAACACACTCTGGAACCTGAGCTTCGCAGGTTAGGCGTTCCCACACGCATG
GTCAAGGGCAAGATTGTCCTGGGTGATGAGAATGGCAAGGGTACTGGCCATCTTGTCTGTAAAGAAGGCGAGGTT
CTGGACTCGCGGCAAACGCGGCTACTCAAGCTCTTTGGAGTCTGTCTCAGCGAGTTTCGAGTCCAAGTAGTAGCA
TACTGGAGTGCAAGCACTAGTCAAGTCACAGAGGTTGATACGTCTGGAATGGAAGTCCAAGATGCGTAG
Transcript >OphauB2|4148
ATGCCCAAGTCGAAGCGCGCAAAAATCGTCCACCTCACCCAAGTCTCAAAAAAGACTCGCCAACACAAGGACAAG
CTCATTGATTCCATTCGCGATGCTTTGCCCAACTACCAGCACTGCCTCATCATTCGCGTGGACAACATGCGCAAC
ACGCACCTCAAAGACGTCCGCCACGAACTCGCCTCCGACTGCCGCCTCTTCTTTGGCAAGACCAAGGTCATGGCC
CGCGCACTCGGCTCCTCTCCCTCGGATGCCATTGCCCCTGGCATCGAGCTCCTGCACAAGCATCTTCACGGCTCT
GTCGGCATCCTTCTCTCCAACAGATCGCCCAGTGACCTTGTCCAATATTTCGAGAACCTGTCCAAGGTTGACTTT
GCCAGGGCTGGTGTGACAGCCTCGCGATCATTTACTGTCCCTCCTGGCGTTGTCTACGCAACTGCTGGCGAGGTT
TCAGTCCAACACGACGTGCCCCTCGAACACACTCTGGAACCTGAGCTTCGCAGGTTAGGCGTTCCCACACGCATG
GTCAAGGGCAAGATTGTCCTGGGTGATGAGAATGGCAAGGGTACTGGCCATCTTGTCTGTAAAGAAGGCGAGGTT
CTGGACTCGCGGCAAACGCGGCTACTCAAGCTCTTTGGAGTCTGTCTCAGCGAGTTTCGAGTCCAAGTAGTAGCA
TACTGGAGTGCAAGCACTAGTCAAGTCACAGAGGTTGATACGTCTGGAATGGAAGTCCAAGATGCGTAG
Gene >OphauB2|4148
ATGCCCAAGTCGAAGCGCGCAAAAATCGTCCACCTCACCCAAGTCTCAAAAAAGACTCGCCAACACAAGGACAAG
CTCATTGATTCCATTCGCGATGCTTTGCCCAACTACCAGCACTGCCTCATCATTCGCGTGGACAACATGCGCAAC
ACGCACCTCAAAGACGTCCGCCACGAACTCGCCTCCGACTGCCGCCTCTTCTTTGGCAAGACCAAGGTCATGGCC
CGCGCACTCGGCTCCTCTCCCTCGGATGCCATTGCCCCTGGCATCGAGCTCCTGCACAAGCATCTTCACGGCTCT
GTCGGCATCCTTCTCTCCAACAGATCGCCCAGTGACCTTGTCCAATATTTCGAGAACCTGTCCAAGGTTGACTTT
GCCAGGGCTGGTGTGACAGCCTCGCGATCATTTACTGTCCCTCCTGGCGTTGTCTACGCAACTGCTGGCGAGGTT
TCAGTCCAACACGACGTGCCCCTCGAACACACTCTGGAACCTGAGCTTCGCAGGTTAGGCGTTCCCACACGCATG
GTCAAGGGCAAGATTGTCCTGGGTGATGAGAATGGCAAGGGTACTGGCCATCTTGTCTGTAAAGAAGGCGAGGTT
CTGGACTCGCGGCAAACGCGGCTACTCAAGCTCTTTGGAGTCTGTCTCAGCGAGTTTCGAGTCCAAGTAGTAGCG
TACGTCCTTGCCCTCTCTCTCTTTCTTTCCATGCCCGAATCACTTGCTTAGCTGCCATCTCTTCAGCTATTAACA
TTGATACAGATACTGGAGTGCAAGCACTAGTCAAGTCACAGAGGTTGATACGTCTGGAATGGAAGTCCAAGATGC
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail