Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4137
Gene name
LocationContig_27:141795..145012
Strand-
Gene length (bp)3217
Transcript length (bp)3021
Coding sequence length (bp)3021
Protein length (aa) 1007

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08424 NRDE-2 NRDE-2, necessary for RNA interference 2.6E-93 232 541

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q80XC6|NRDE2_MOUSE Protein NRDE2 homolog OS=Mus musculus GN=Nrde2 PE=1 SV=3 196 1001 8.0E-33
sp|O42975|NRDE2_SCHPO Protein NRDE2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.05 PE=1 SV=1 2 1005 8.0E-31
sp|Q9H7Z3|NRDE2_HUMAN Protein NRDE2 homolog OS=Homo sapiens GN=NRDE2 PE=1 SV=3 196 552 3.0E-21
sp|Q54QP0|NRDE2_DICDI Protein NRDE2 homolog OS=Dictyostelium discoideum GN=nrde2 PE=3 SV=1 232 450 8.0E-13
sp|Q9H7Z3|NRDE2_HUMAN Protein NRDE2 homolog OS=Homo sapiens GN=NRDE2 PE=1 SV=3 837 1001 8.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4137
MADRKLSAPKFSSFKSKPPAAASAPKHHDQDEASSRQPHRRHSKHRHQVPREPNHGPDAKHTARRAAAASVPGLF
VIDKKGDALIRKYGPDRAKVPPYYRWGRGRVLGTKARLVVHRDGPAEEFSLVFPGDAAPRQRDGLRTRGGKEKSV
RLRASATAVEEDPGDYIALENPKKKRRVWQEDGVSDGDEGPSWRSIEGKAKPVEESDASDSDASSSADAVTEADG
SNALKWKHIQLNRRVKEQPADVDGWLELVDLQDALLRQDTTSDVRATESARHSYTEIKVHMLESALAHASEPRDR
QRILVPLMYHGVRIWSREVAAKKWLQVADDERDNFALWKVHVDFAMSSISTFDYQAIKKMLVDRLRLTVARTGLE
AEQDAEEAVHVFLRATRFMQDAGYGEVAVAAWQGLLEMNFFAPKCTGDGSVAMAAFRDFWESEVPRIGEANAQGW
RHFVDNGGEAPEPLPAASMQQAQASKNAYRTWASGEEERAARAKMPARTMDAGTDDDPFRIVTFDDIAPLLFHQP
KMSRLLIDAFFIFCQISAPIFADCAYMQTASTDPFVATADIHSPPAAPQHLPDAPRKPPNMSSANLCARVSQSLL
FDASWFRCINNAVAGVDAAWVDATLRQLVYAAGEADLAGLYLGVCVARGTGGTRRLGKALLGSFSTEARLYAAYA
CAELASGNEEMAEKVLFSAAQSASLSLGPNGPILFSTWAWLELQRGSKTAAVKRLCAAVDASMRTSLQTNQDAVS
PALVLKAQQFFSSNAEAQLYQGHEDEASMNIECLVLLSYLTDEGGTEPASATQGNISAAMDTIKSRSNTLCTHRR
CYELVLQSAARLLYWHSTKGPFRRIHLREQFSFFIDAFPQNTMFLRLFAWADTGIRVIDETRQLLHDKVFVAKAS
VTSHAFAIEHELERGRVHAAQGAFEQALMGEASSCATLWRSYLRFCQAHVSEASGGRQVAFRALKHCPWAKGVAL
DAIKTMADEAEAKIIYDAMAAKGLRIHTDLE*
Coding >OphauB2|4137
ATGGCAGACAGAAAACTCAGCGCACCCAAGTTCTCGTCATTCAAGTCCAAGCCGCCCGCGGCAGCATCTGCGCCA
AAACACCATGACCAAGATGAAGCATCATCTCGACAGCCTCACCGCCGACACTCCAAGCACCGCCACCAAGTGCCA
CGCGAGCCTAATCACGGCCCGGATGCCAAACACACAGCTCGACGCGCGGCCGCTGCATCAGTGCCGGGACTCTTT
GTCATTGACAAAAAGGGCGATGCGCTGATTCGCAAGTATGGGCCAGACCGCGCCAAGGTGCCGCCCTACTACCGC
TGGGGACGCGGCCGAGTGCTGGGGACCAAGGCGCGGCTTGTGGTGCATCGTGACGGGCCGGCCGAGGAGTTTAGC
CTCGTGTTTCCTGGAGACGCGGCGCCGCGGCAGAGAGATGGCTTGAGGACGCGGGGCGGCAAGGAGAAGAGTGTT
AGACTGCGCGCGAGTGCTACGGCTGTGGAAGAGGACCCGGGGGACTACATTGCGTTGGAGAATCCGAAAAAGAAA
AGACGAGTGTGGCAAGAGGATGGGGTGTCGGACGGAGATGAAGGGCCGTCGTGGAGGTCTATAGAAGGCAAGGCG
AAGCCTGTTGAAGAGAGCGATGCGTCAGACAGCGATGCTTCCAGCTCGGCAGATGCGGTGACGGAGGCGGATGGC
AGTAATGCCCTCAAGTGGAAACACATTCAGCTCAACAGACGGGTCAAGGAGCAGCCTGCTGATGTCGATGGCTGG
CTGGAGCTGGTGGACCTCCAAGACGCGCTGCTGCGGCAAGACACAACAAGTGACGTGCGAGCCACGGAGAGCGCA
AGGCATAGCTACACGGAAATCAAGGTGCACATGCTCGAGTCTGCGCTGGCCCATGCCTCTGAGCCCCGAGACCGG
CAGCGTATCCTGGTGCCGCTAATGTACCACGGCGTCAGGATCTGGAGCAGAGAGGTTGCCGCCAAGAAGTGGCTC
CAAGTTGCAGACGACGAGCGGGACAATTTCGCGCTGTGGAAAGTCCATGTCGACTTTGCCATGTCGAGCATCTCT
ACCTTTGACTATCAGGCGATTAAGAAGATGCTGGTTGACCGGCTGCGGCTCACTGTCGCGCGTACTGGCCTCGAG
GCAGAACAAGACGCCGAGGAAGCCGTGCATGTTTTCCTACGGGCCACGAGATTTATGCAGGATGCTGGATATGGA
GAAGTTGCGGTTGCGGCGTGGCAGGGCTTGCTGGAGATGAATTTTTTCGCTCCCAAATGCACGGGAGATGGCAGC
GTCGCCATGGCTGCGTTTCGAGACTTTTGGGAGAGCGAGGTGCCGAGGATTGGAGAGGCCAATGCGCAGGGATGG
CGACACTTTGTCGACAATGGCGGCGAGGCGCCTGAGCCCTTGCCAGCCGCCTCGATGCAGCAGGCCCAGGCGTCC
AAGAATGCATACCGCACATGGGCGTCTGGTGAAGAGGAGCGCGCTGCCAGGGCCAAGATGCCAGCACGGACAATG
GATGCAGGCACCGACGACGATCCCTTTCGCATCGTCACCTTTGACGACATTGCGCCTCTTCTCTTCCACCAGCCA
AAAATGTCGCGCCTCCTCATTGATGCCTTTTTCATCTTTTGCCAAATCTCAGCCCCCATCTTTGCCGACTGCGCC
TACATGCAAACCGCATCCACCGACCCCTTTGTCGCCACGGCAGATATTCATTCCCCCCCCGCCGCGCCACAGCAC
CTCCCCGATGCGCCGCGCAAGCCGCCCAACATGAGCAGCGCCAACCTGTGCGCGCGCGTCTCCCAAAGTCTCCTC
TTTGACGCGTCTTGGTTTCGCTGCATCAACAATGCCGTTGCTGGCGTCGACGCGGCGTGGGTGGACGCGACGCTC
AGACAGCTCGTCTACGCGGCCGGAGAGGCAGACTTGGCGGGCCTTTACTTGGGCGTGTGCGTGGCGCGCGGGACG
GGCGGGACGAGGAGGCTGGGCAAGGCGTTGCTGGGCAGCTTTTCCACAGAGGCGCGCTTGTATGCGGCGTATGCG
TGTGCTGAGCTGGCAAGTGGGAATGAGGAAATGGCGGAAAAGGTGCTTTTTAGTGCGGCACAGTCTGCGTCGCTG
TCTTTGGGACCCAATGGACCCATCCTCTTCAGCACTTGGGCCTGGCTTGAACTGCAAAGAGGCAGCAAGACTGCA
GCAGTCAAGCGCCTGTGTGCTGCTGTTGATGCTTCCATGCGCACGTCACTACAGACAAACCAAGACGCTGTGTCT
CCGGCTCTTGTTCTCAAGGCGCAGCAATTCTTCTCGTCCAATGCAGAAGCCCAGTTATACCAAGGACATGAAGAC
GAGGCCAGCATGAATATTGAATGTCTTGTCCTCCTCTCCTACCTGACAGACGAGGGCGGCACTGAGCCTGCCTCG
GCGACGCAGGGCAACATCTCTGCTGCCATGGACACTATCAAATCCAGGTCGAATACTCTTTGCACACACCGCCGC
TGCTACGAGCTGGTTTTGCAATCTGCCGCAAGACTGCTCTATTGGCATTCGACAAAAGGACCATTTCGAAGGATT
CATCTACGAGAGCAATTCTCATTCTTCATCGACGCATTCCCGCAAAACACAATGTTTTTGCGTCTCTTTGCATGG
GCCGACACTGGCATCCGCGTTATTGACGAGACGCGCCAGTTGCTCCATGACAAGGTATTCGTCGCAAAGGCTAGT
GTGACGAGTCACGCGTTTGCCATTGAGCATGAACTGGAGCGCGGGAGGGTGCATGCAGCACAGGGTGCATTTGAG
CAGGCCCTCATGGGCGAGGCATCGTCATGTGCGACGCTGTGGAGAAGCTACCTGCGCTTTTGCCAGGCACATGTG
TCGGAGGCGAGTGGTGGCAGGCAAGTCGCCTTTCGTGCCCTGAAGCATTGTCCCTGGGCAAAGGGCGTGGCGCTG
GATGCCATCAAGACCATGGCGGATGAGGCTGAGGCCAAGATTATCTACGATGCCATGGCGGCAAAGGGACTGCGC
ATACACACTGATCTGGAGTGA
Transcript >OphauB2|4137
ATGGCAGACAGAAAACTCAGCGCACCCAAGTTCTCGTCATTCAAGTCCAAGCCGCCCGCGGCAGCATCTGCGCCA
AAACACCATGACCAAGATGAAGCATCATCTCGACAGCCTCACCGCCGACACTCCAAGCACCGCCACCAAGTGCCA
CGCGAGCCTAATCACGGCCCGGATGCCAAACACACAGCTCGACGCGCGGCCGCTGCATCAGTGCCGGGACTCTTT
GTCATTGACAAAAAGGGCGATGCGCTGATTCGCAAGTATGGGCCAGACCGCGCCAAGGTGCCGCCCTACTACCGC
TGGGGACGCGGCCGAGTGCTGGGGACCAAGGCGCGGCTTGTGGTGCATCGTGACGGGCCGGCCGAGGAGTTTAGC
CTCGTGTTTCCTGGAGACGCGGCGCCGCGGCAGAGAGATGGCTTGAGGACGCGGGGCGGCAAGGAGAAGAGTGTT
AGACTGCGCGCGAGTGCTACGGCTGTGGAAGAGGACCCGGGGGACTACATTGCGTTGGAGAATCCGAAAAAGAAA
AGACGAGTGTGGCAAGAGGATGGGGTGTCGGACGGAGATGAAGGGCCGTCGTGGAGGTCTATAGAAGGCAAGGCG
AAGCCTGTTGAAGAGAGCGATGCGTCAGACAGCGATGCTTCCAGCTCGGCAGATGCGGTGACGGAGGCGGATGGC
AGTAATGCCCTCAAGTGGAAACACATTCAGCTCAACAGACGGGTCAAGGAGCAGCCTGCTGATGTCGATGGCTGG
CTGGAGCTGGTGGACCTCCAAGACGCGCTGCTGCGGCAAGACACAACAAGTGACGTGCGAGCCACGGAGAGCGCA
AGGCATAGCTACACGGAAATCAAGGTGCACATGCTCGAGTCTGCGCTGGCCCATGCCTCTGAGCCCCGAGACCGG
CAGCGTATCCTGGTGCCGCTAATGTACCACGGCGTCAGGATCTGGAGCAGAGAGGTTGCCGCCAAGAAGTGGCTC
CAAGTTGCAGACGACGAGCGGGACAATTTCGCGCTGTGGAAAGTCCATGTCGACTTTGCCATGTCGAGCATCTCT
ACCTTTGACTATCAGGCGATTAAGAAGATGCTGGTTGACCGGCTGCGGCTCACTGTCGCGCGTACTGGCCTCGAG
GCAGAACAAGACGCCGAGGAAGCCGTGCATGTTTTCCTACGGGCCACGAGATTTATGCAGGATGCTGGATATGGA
GAAGTTGCGGTTGCGGCGTGGCAGGGCTTGCTGGAGATGAATTTTTTCGCTCCCAAATGCACGGGAGATGGCAGC
GTCGCCATGGCTGCGTTTCGAGACTTTTGGGAGAGCGAGGTGCCGAGGATTGGAGAGGCCAATGCGCAGGGATGG
CGACACTTTGTCGACAATGGCGGCGAGGCGCCTGAGCCCTTGCCAGCCGCCTCGATGCAGCAGGCCCAGGCGTCC
AAGAATGCATACCGCACATGGGCGTCTGGTGAAGAGGAGCGCGCTGCCAGGGCCAAGATGCCAGCACGGACAATG
GATGCAGGCACCGACGACGATCCCTTTCGCATCGTCACCTTTGACGACATTGCGCCTCTTCTCTTCCACCAGCCA
AAAATGTCGCGCCTCCTCATTGATGCCTTTTTCATCTTTTGCCAAATCTCAGCCCCCATCTTTGCCGACTGCGCC
TACATGCAAACCGCATCCACCGACCCCTTTGTCGCCACGGCAGATATTCATTCCCCCCCCGCCGCGCCACAGCAC
CTCCCCGATGCGCCGCGCAAGCCGCCCAACATGAGCAGCGCCAACCTGTGCGCGCGCGTCTCCCAAAGTCTCCTC
TTTGACGCGTCTTGGTTTCGCTGCATCAACAATGCCGTTGCTGGCGTCGACGCGGCGTGGGTGGACGCGACGCTC
AGACAGCTCGTCTACGCGGCCGGAGAGGCAGACTTGGCGGGCCTTTACTTGGGCGTGTGCGTGGCGCGCGGGACG
GGCGGGACGAGGAGGCTGGGCAAGGCGTTGCTGGGCAGCTTTTCCACAGAGGCGCGCTTGTATGCGGCGTATGCG
TGTGCTGAGCTGGCAAGTGGGAATGAGGAAATGGCGGAAAAGGTGCTTTTTAGTGCGGCACAGTCTGCGTCGCTG
TCTTTGGGACCCAATGGACCCATCCTCTTCAGCACTTGGGCCTGGCTTGAACTGCAAAGAGGCAGCAAGACTGCA
GCAGTCAAGCGCCTGTGTGCTGCTGTTGATGCTTCCATGCGCACGTCACTACAGACAAACCAAGACGCTGTGTCT
CCGGCTCTTGTTCTCAAGGCGCAGCAATTCTTCTCGTCCAATGCAGAAGCCCAGTTATACCAAGGACATGAAGAC
GAGGCCAGCATGAATATTGAATGTCTTGTCCTCCTCTCCTACCTGACAGACGAGGGCGGCACTGAGCCTGCCTCG
GCGACGCAGGGCAACATCTCTGCTGCCATGGACACTATCAAATCCAGGTCGAATACTCTTTGCACACACCGCCGC
TGCTACGAGCTGGTTTTGCAATCTGCCGCAAGACTGCTCTATTGGCATTCGACAAAAGGACCATTTCGAAGGATT
CATCTACGAGAGCAATTCTCATTCTTCATCGACGCATTCCCGCAAAACACAATGTTTTTGCGTCTCTTTGCATGG
GCCGACACTGGCATCCGCGTTATTGACGAGACGCGCCAGTTGCTCCATGACAAGGTATTCGTCGCAAAGGCTAGT
GTGACGAGTCACGCGTTTGCCATTGAGCATGAACTGGAGCGCGGGAGGGTGCATGCAGCACAGGGTGCATTTGAG
CAGGCCCTCATGGGCGAGGCATCGTCATGTGCGACGCTGTGGAGAAGCTACCTGCGCTTTTGCCAGGCACATGTG
TCGGAGGCGAGTGGTGGCAGGCAAGTCGCCTTTCGTGCCCTGAAGCATTGTCCCTGGGCAAAGGGCGTGGCGCTG
GATGCCATCAAGACCATGGCGGATGAGGCTGAGGCCAAGATTATCTACGATGCCATGGCGGCAAAGGGACTGCGC
ATACACACTGATCTGGAGTGA
Gene >OphauB2|4137
ATGGCAGACAGAAAACTCAGCGCACCCAAGTTCTCGTCATTCAAGTCCAAGCCGCCCGCGGCAGCATCTGCGCCA
AAACACCATGACCAAGATGAAGCATCATCTCGACAGCCTCACCGCCGACACTCCAAGCACCGCCACCAAGTGCCA
CGCGAGCCTAATCACGGCCCGGATGCCAAACACACAGCTCGACGCGCGGCCGCTGCATCAGTGCCGGGACTCTTT
GTCATTGACAAAAAGGGCGATGCGCTGATTCGCAAGTATGGGCCAGACCGCGCCAAGGTGCCGCCCTACTACCGC
TGGGGACGCGGCCGAGTGCTGGGGACCAAGGCGCGGCTTGTGGTGCATCGTGACGGGCCGGCCGAGGAGTTTAGC
CTCGTGTTTCCTGGAGACGCGGCGCCGCGGCAGAGAGATGGCTTGAGGACGCGGGGCGGCAAGGAGAAGAGTGTT
AGACTGCGCGCGAGTGCTACGGCTGTGGAAGAGGACCCGGGGGACTACATTGCGTTGGAGAATCCGAAAAAGAAA
AGACGAGTGTGGCAAGAGGATGGGGTGTCGGACGGAGATGAAGGGCCGTCGTGGAGGTCTATAGAAGGCAAGGCG
AAGCCTGTTGAAGAGAGCGATGCGTCAGACAGCGATGCTTCCAGCTCGGCAGATGCGGTGACGGAGGCGGATGGC
AGTAATGCCCTCAAGTGGAAACACATTCAGCTCAACAGACGGGTCAAGGAGCAGCCTGCTGATGTCGATGGCTGG
CTGGAGCTGGTGGACCTCCAAGACGCGCTGCTGCGGCAAGACACAACAAGTGACGTGCGAGCCACGGAGAGCGCA
AGGCATAGCTACACGGAAATCAAGGTGCACATGCTCGAGTCTGCGCTGGCCCATGCCTCTGAGCCCCGAGACCGG
CAGCGTATCCTGGTGCCGCTAATGTACCACGGCGTCAGGATCTGGAGCAGAGAGGTTGCCGCCAAGAAGTGGCTC
CAAGTTGCAGACGACGAGCGGGACAATTTCGCGCTGTGGAAAGTCCATGTCGACTTTGCCATGTCGAGCATCTCT
ACCTTTGACTATCAGGCGATTAAGAAGATGCTGGTTGACCGGCTGCGGCTCACTGTCGCGCGTACTGGCCTCGAG
GCAGAACAAGACGCCGAGGAAGCCGTGCATGTTTTCCTACGGGCCACGAGATTTATGCAGGATGCTGGATATGGA
GAAGTTGCGGTTGCGGCGTGGCAGGGCTTGCTGGAGATGAATTTTTTCGCTCCCAAATGCACGGGAGATGGCAGC
GTCGCCATGGCTGCGTTTCGAGACTTTTGGGAGAGCGAGGTGCCGAGGATTGGAGAGGCCAATGCGCAGGGATGG
CGACACTTTGTCGACAATGGCGGCGAGGCGCCTGAGCCCTTGCCAGCCGCCTCGATGCAGCAGGCCCAGGCGTCC
AAGAATGCATACCGCACATGGGCGTCTGGTGAAGAGGAGCGCGCTGCCAGGGCCAAGATGCCAGCACGGACAATG
GATGCAGGCACCGACGACGATCCCTTTCGCATCGTCACCTTTGACGACATTGCGCCTCTTCTCTTCCACCAGCCA
AAAATGTCGCGCCTCCTCATTGATGCCTTTTTCATCTTTTGCCAAATCTCAGCCCCCATCTTTGCCGACTGCGCC
TACATGCAAACCGCATCCACCGACCCCTTTGTCGCCACGGCAGATATTCATTCCCCCCCCGCCGCGCCACAGCAC
CTCCCCGATGCGCCGCGCAAGCCGCCCAACATGAGCAGCGCCAACCTGTGCGCGCGCGTCTCCCAAAGTCTCCTC
TTTGACGCGTCTTGGTTTCGCTGCATCAACAATGCCGTTGCTGGCGTCGACGCGGCGTGGGTGGACGCGACGCTC
AGACAGCTCGTCTACGCGGCCGGAGAGGCAGACTTGGCGGGCCTTTACTTGGGCGTGTGCGTGGCGCGCGGGACG
GGCGGGACGAGGAGGCTGGGCAAGGCGTTGCTGGGCAGCTTTTCCACAGAGGCGCGCTTGTATGCGGCGTATGCG
TGTGCTGAGCTGGCAAGTGGGAATGAGGAAATGGCGGAAAAGGTGCTTTTTAGTGCGGCACAGTCTGCGTCGGTG
AGTCCAATTGTCTTTTCCTTTTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTCTATATTGT
GTATTTTGGCTACAAGCTTCAAGCAACTTCTCCTTGAGCTTGGTGCTAACGCGGCGTGTAGCTGTCTTTGGGACC
CAATGGACCCATCCTCTTCAGCACTTGGGCCTGGCTTGAACTGCAAAGAGGCAGCAAGACTGCAGCAGTCAAGCG
CCTGTGTGCTGCTGTTGATGCTTCCATGCGCACGTCACTACAGACAAACCAAGACGCTGTGTCTCCGGCTCTTGT
TCTCAAGGCGCAGCAATTCTTCTCGTCCAATGCAGAAGCCCAGTTATACCAAGGACATGAAGACGAGGCCAGCAT
GAATATTGAATGTCTTGTCCTCCTCTCCTACCTGACAGACGAGGGCGGCACTGAGCCTGCCTCGGCGACGCAGGG
CAACATCTCTGCTGCCATGGACACTATCAAATCCAGGTCGAATACTCTTTGCACACACCGCCGCTGCTACGAGCT
GGTTTTGCAATCTGCCGCAAGACTGCTCTATTGGCATTCGACAAAAGGGTGAGCGACTGTACCCTTGACTGCACC
TTGGCAACGTTTTGAAGCTAACAATGACAGACCATTTCGAAGGATTCATCTACGAGAGCAATTCTCATTCTTCAT
CGACGCATTCCCGCAAAACACAATGTTTTTGCGTCTCTTTGCATGGGCCGACACTGGCATCCGCGTTATTGACGA
GACGCGCCAGTTGCTCCATGACAAGGTATTCGTCGCAAAGGCTAGTGTGACGAGTCACGCGTTTGCCATTGAGCA
TGAACTGGAGCGCGGGAGGGTGCATGCAGCACAGGGTGCATTTGAGCAGGCCCTCATGGGCGAGGCATCGTCATG
TGCGACGCTGTGGAGAAGCTACCTGCGCTTTTGCCAGGCACATGTGTCGGAGGCGAGTGGTGGCAGGCAAGTCGC
CTTTCGTGCCCTGAAGCATTGTCCCTGGGCAAAGGGCGTGGCGCTGGATGCCATCAAGACCATGGCGGATGAGGC
TGAGGCCAAGATTATCTACGATGCCATGGCGGCAAAGGGACTGCGCATACACACTGATCTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail