Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4136
Gene name
LocationContig_27:138926..141081
Strand-
Gene length (bp)2155
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain 3.4E-64 108 346
PF00387 PI-PLC-Y Phosphatidylinositol-specific phospholipase C, Y domain 1.5E-39 404 514

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40977|PLC1_SCHPO 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plc1 PE=1 SV=1 257 682 2.0E-54
sp|O13433|PLC1_CANAX 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Candida albicans GN=PLC1 PE=3 SV=1 256 681 3.0E-49
sp|Q8N3E9|PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens GN=PLCD3 PE=1 SV=3 256 683 5.0E-49
sp|Q8K2J0|PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus GN=Plcd3 PE=1 SV=2 256 683 1.0E-48
sp|A5D6R3|PLD3A_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A OS=Danio rerio GN=plcd3a PE=2 SV=1 256 665 6.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40977|PLC1_SCHPO 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plc1 PE=1 SV=1 257 682 2.0E-54
sp|O13433|PLC1_CANAX 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Candida albicans GN=PLC1 PE=3 SV=1 256 681 3.0E-49
sp|Q8N3E9|PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens GN=PLCD3 PE=1 SV=3 256 683 5.0E-49
sp|Q8K2J0|PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus GN=Plcd3 PE=1 SV=2 256 683 1.0E-48
sp|A5D6R3|PLD3A_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A OS=Danio rerio GN=plcd3a PE=2 SV=1 256 665 6.0E-46
sp|P32383|PLC1_YEAST 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLC1 PE=1 SV=1 257 671 5.0E-43
sp|Q9BRC7|PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens GN=PLCD4 PE=2 SV=1 256 666 4.0E-41
sp|Q5RET0|PLCD4_PONAB 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Pongo abelii GN=PLCD4 PE=2 SV=1 256 669 2.0E-40
sp|Q8SPR7|PLCD4_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Sus scrofa GN=PLCD4 PE=2 SV=1 256 666 1.0E-39
sp|P10895|PLCD1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Bos taurus GN=PLCD1 PE=2 SV=2 256 680 4.0E-39
sp|Q8K394|PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus GN=Plcl2 PE=1 SV=2 256 673 1.0E-38
sp|Q9UPR0|PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens GN=PLCL2 PE=1 SV=2 256 673 2.0E-38
sp|Q4R6L3|PLCD4_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Macaca fascicularis GN=PLCD4 PE=2 SV=1 256 666 2.0E-37
sp|Q32NH8|PLCD4_XENLA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Xenopus laevis GN=plcd4 PE=2 SV=1 256 666 2.0E-37
sp|P10688|PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus GN=Plcd1 PE=1 SV=1 256 680 9.0E-37
sp|P51178|PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens GN=PLCD1 PE=1 SV=2 256 680 5.0E-36
sp|Q62711|PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus GN=Plcd4 PE=1 SV=1 256 666 2.0E-35
sp|Q8R3B1|PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus GN=Plcd1 PE=1 SV=2 256 669 4.0E-35
sp|Q15111|PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens GN=PLCL1 PE=1 SV=3 256 669 4.0E-34
sp|Q15147|PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens GN=PLCB4 PE=1 SV=3 256 666 9.0E-33
sp|Q9QW07|PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus GN=Plcb4 PE=1 SV=2 256 666 1.0E-32
sp|Q3USB7|PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus GN=Plcl1 PE=1 SV=3 256 669 1.0E-32
sp|Q2VRL0|PLCZ1_CHICK 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Gallus gallus GN=PLCZ1 PE=2 SV=1 256 669 2.0E-32
sp|Q8K4D7|PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus GN=Plcz1 PE=1 SV=1 256 513 2.0E-32
sp|Q5FX52|PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus GN=Plcz1 PE=2 SV=1 256 513 3.0E-32
sp|Q62688|PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus GN=Plcl1 PE=1 SV=1 256 669 7.0E-32
sp|Q8K3R3|PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus GN=Plcd4 PE=1 SV=2 256 666 5.0E-31
sp|Q1RML2|PLCZ1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Bos taurus GN=PLCZ1 PE=2 SV=1 256 513 6.0E-30
sp|Q86YW0|PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens GN=PLCZ1 PE=2 SV=1 256 670 1.0E-29
sp|Q95JS1|PLCZ1_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Macaca fascicularis GN=PLCZ1 PE=2 SV=1 256 670 3.0E-28
sp|Q7YRU3|PLCZ1_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Sus scrofa GN=PLCZ PE=2 SV=1 256 513 6.0E-26
sp|Q00722|PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens GN=PLCB2 PE=1 SV=2 256 512 1.0E-24
sp|A3KGF7|PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus GN=Plcb2 PE=1 SV=1 256 512 3.0E-24
sp|Q9LY51|PLCD7_ARATH Phosphoinositide phospholipase C 7 OS=Arabidopsis thaliana GN=PLC7 PE=1 SV=1 259 681 5.0E-24
sp|P10687|PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus GN=Plcb1 PE=1 SV=1 256 513 1.0E-23
sp|Q9Z1B3|PLCB1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Mus musculus GN=Plcb1 PE=1 SV=2 256 513 2.0E-23
sp|O89040|PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus GN=Plcb2 PE=2 SV=1 256 512 2.0E-23
sp|Q9NQ66|PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens GN=PLCB1 PE=1 SV=1 256 513 3.0E-23
sp|Q39033|PLCD2_ARATH Phosphoinositide phospholipase C 2 OS=Arabidopsis thaliana GN=PLC2 PE=1 SV=1 259 681 3.0E-23
sp|P10894|PLCB1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Bos taurus GN=PLCB1 PE=1 SV=1 256 513 8.0E-23
sp|Q56W08|PLCD3_ARATH Phosphoinositide phospholipase C 3 OS=Arabidopsis thaliana GN=PLC3 PE=2 SV=1 259 670 1.0E-21
sp|P13217|PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster GN=norpA PE=1 SV=4 256 664 2.0E-21
sp|Q944C2|PLCD5_ARATH Phosphoinositide phospholipase C 5 OS=Arabidopsis thaliana GN=PLC5 PE=2 SV=2 259 678 2.0E-21
sp|P21671|PLCD4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Bos taurus GN=PLCD4 PE=1 SV=2 390 666 3.0E-21
sp|Q944C1|PLCD4_ARATH Phosphoinositide phospholipase C 4 OS=Arabidopsis thaliana GN=PLC4 PE=2 SV=2 259 681 3.0E-21
sp|Q8GV43|PLCD6_ARATH Phosphoinositide phospholipase C 6 OS=Arabidopsis thaliana GN=PLC6 PE=2 SV=2 248 679 1.0E-20
sp|Q8CIH5|PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus GN=Plcg2 PE=1 SV=1 256 373 6.0E-20
sp|Q4R6L3|PLCD4_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Macaca fascicularis GN=PLCD4 PE=2 SV=1 37 160 2.0E-19
sp|P24135|PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus GN=Plcg2 PE=1 SV=1 256 373 2.0E-19
sp|Q5RET0|PLCD4_PONAB 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Pongo abelii GN=PLCD4 PE=2 SV=1 37 160 3.0E-19
sp|P16885|PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens GN=PLCG2 PE=1 SV=4 256 349 7.0E-19
sp|Q07722|PLCB4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Bos taurus GN=PLCB4 PE=1 SV=1 256 666 8.0E-19
sp|Q9BRC7|PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens GN=PLCD4 PE=2 SV=1 37 160 1.0E-18
sp|P19174|PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens GN=PLCG1 PE=1 SV=1 257 345 2.0E-18
sp|Q39032|PLCD1_ARATH Phosphoinositide phospholipase C 1 OS=Arabidopsis thaliana GN=PLC1 PE=2 SV=1 248 670 3.0E-18
sp|Q8SPR7|PLCD4_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Sus scrofa GN=PLCD4 PE=2 SV=1 37 160 4.0E-18
sp|Q8K3R3|PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus GN=Plcd4 PE=1 SV=2 37 160 6.0E-18
sp|P08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus GN=PLCG1 PE=1 SV=1 257 345 9.0E-18
sp|Q62077|PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus GN=Plcg1 PE=1 SV=2 257 345 1.0E-17
sp|Q62711|PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus GN=Plcd4 PE=1 SV=1 37 160 2.0E-17
sp|P21671|PLCD4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Bos taurus GN=PLCD4 PE=1 SV=2 35 160 2.0E-17
sp|P10686|PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus GN=Plcg1 PE=1 SV=1 257 345 3.0E-17
sp|Q8CIH5|PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus GN=Plcg2 PE=1 SV=1 51 160 5.0E-17
sp|Q4KWH8|PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens GN=PLCH1 PE=1 SV=1 373 664 5.0E-17
sp|P24135|PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus GN=Plcg2 PE=1 SV=1 51 160 6.0E-17
sp|P16885|PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens GN=PLCG2 PE=1 SV=4 21 160 1.0E-16
sp|P19174|PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens GN=PLCG1 PE=1 SV=1 77 159 2.0E-16
sp|Q4KWH8|PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens GN=PLCH1 PE=1 SV=1 84 160 2.0E-16
sp|Q4KWH5|PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus GN=Plch1 PE=2 SV=1 84 160 2.0E-16
sp|Q8K2J0|PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus GN=Plcd3 PE=1 SV=2 35 160 3.0E-16
sp|P08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus GN=PLCG1 PE=1 SV=1 77 159 3.0E-16
sp|Q2VRL0|PLCZ1_CHICK 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Gallus gallus GN=PLCZ1 PE=2 SV=1 37 160 4.0E-16
sp|P10686|PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus GN=Plcg1 PE=1 SV=1 77 159 4.0E-16
sp|Q4KWH5|PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus GN=Plch1 PE=2 SV=1 394 664 4.0E-16
sp|O13433|PLC1_CANAX 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Candida albicans GN=PLC1 PE=3 SV=1 37 185 5.0E-16
sp|Q8N3E9|PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens GN=PLCD3 PE=1 SV=3 35 160 7.0E-16
sp|Q02158|PLC_DICDI 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Dictyostelium discoideum GN=plc PE=2 SV=1 105 160 9.0E-16
sp|Q8K4S1|PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus GN=Plce1 PE=1 SV=3 257 337 9.0E-16
sp|Q62077|PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus GN=Plcg1 PE=1 SV=2 77 159 1.0E-15
sp|Q4KWH8|PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens GN=PLCH1 PE=1 SV=1 256 348 1.0E-15
sp|Q99P84|PLCE1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus GN=Plce1 PE=1 SV=1 257 337 1.0E-15
sp|O75038|PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens GN=PLCH2 PE=2 SV=3 394 664 2.0E-15
sp|A2AP18|PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus GN=Plch2 PE=1 SV=2 394 664 2.0E-15
sp|Q32NH8|PLCD4_XENLA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Xenopus laevis GN=plcd4 PE=2 SV=1 40 160 6.0E-15
sp|A5D6R3|PLD3A_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A OS=Danio rerio GN=plcd3a PE=2 SV=1 85 160 8.0E-15
sp|P10687|PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus GN=Plcb1 PE=1 SV=1 62 160 1.0E-14
sp|Q9NQ66|PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens GN=PLCB1 PE=1 SV=1 62 160 1.0E-14
sp|P10894|PLCB1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Bos taurus GN=PLCB1 PE=1 SV=1 62 160 1.0E-14
sp|O75038|PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens GN=PLCH2 PE=2 SV=3 82 160 1.0E-14
sp|P32383|PLC1_YEAST 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLC1 PE=1 SV=1 66 159 2.0E-14
sp|Q95JS1|PLCZ1_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Macaca fascicularis GN=PLCZ1 PE=2 SV=1 82 160 2.0E-14
sp|Q9Z1B3|PLCB1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Mus musculus GN=Plcb1 PE=1 SV=2 62 160 2.0E-14
sp|Q99P84|PLCE1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus GN=Plce1 PE=1 SV=1 429 514 2.0E-14
sp|A2AP18|PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus GN=Plch2 PE=1 SV=2 82 160 2.0E-14
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 257 335 2.0E-14
sp|G5EBH0|PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans GN=egl-8 PE=1 SV=1 396 664 4.0E-14
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 429 514 5.0E-14
sp|A2AP18|PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus GN=Plch2 PE=1 SV=2 256 348 7.0E-14
sp|Q86YW0|PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens GN=PLCZ1 PE=2 SV=1 82 160 8.0E-14
sp|Q4KWH5|PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus GN=Plch1 PE=2 SV=1 256 348 8.0E-14
sp|O75038|PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens GN=PLCH2 PE=2 SV=3 256 348 8.0E-14
sp|P25455|PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster GN=Plc21C PE=2 SV=3 388 673 8.0E-14
sp|P25455|PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster GN=Plc21C PE=2 SV=3 82 156 1.0E-13
sp|Q01970|PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens GN=PLCB3 PE=1 SV=2 350 513 1.0E-13
sp|Q02158|PLC_DICDI 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Dictyostelium discoideum GN=plc PE=2 SV=1 256 343 2.0E-13
sp|Q8K4S1|PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus GN=Plce1 PE=1 SV=3 429 514 2.0E-13
sp|Q8K4D7|PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus GN=Plcz1 PE=1 SV=1 82 160 3.0E-13
sp|Q8K394|PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus GN=Plcl2 PE=1 SV=2 82 160 5.0E-13
sp|Q9UPR0|PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens GN=PLCL2 PE=1 SV=2 82 160 5.0E-13
sp|Q99P84|PLCE1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus GN=Plce1 PE=1 SV=1 104 159 5.0E-13
sp|P51432|PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus GN=Plcb3 PE=1 SV=2 402 513 5.0E-13
sp|P16885|PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens GN=PLCG2 PE=1 SV=4 449 666 7.0E-13
sp|G5EBH0|PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans GN=egl-8 PE=1 SV=1 256 345 7.0E-13
sp|Q1RML2|PLCZ1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Bos taurus GN=PLCZ1 PE=2 SV=1 82 160 8.0E-13
sp|Q99JE6|PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus GN=Plcb3 PE=1 SV=2 402 513 1.0E-12
sp|Q8R3B1|PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus GN=Plcd1 PE=1 SV=2 2 160 2.0E-12
sp|Q5FX52|PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus GN=Plcz1 PE=2 SV=1 82 160 2.0E-12
sp|Q8K4S1|PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus GN=Plce1 PE=1 SV=3 104 159 2.0E-12
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 110 159 2.0E-12
sp|P10895|PLCD1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Bos taurus GN=PLCD1 PE=2 SV=2 5 160 3.0E-12
sp|P51178|PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens GN=PLCD1 PE=1 SV=2 85 160 3.0E-12
sp|Q8CIH5|PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus GN=Plcg2 PE=1 SV=1 449 666 3.0E-12
sp|P10688|PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus GN=Plcd1 PE=1 SV=1 85 160 4.0E-12
sp|Q01970|PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens GN=PLCB3 PE=1 SV=2 256 351 4.0E-12
sp|P51432|PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus GN=Plcb3 PE=1 SV=2 256 366 4.0E-12
sp|P40977|PLC1_SCHPO 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plc1 PE=1 SV=1 40 159 5.0E-12
sp|Q7YRU3|PLCZ1_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Sus scrofa GN=PLCZ PE=2 SV=1 105 160 5.0E-12
sp|Q07722|PLCB4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Bos taurus GN=PLCB4 PE=1 SV=1 105 156 8.0E-12
sp|Q15147|PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens GN=PLCB4 PE=1 SV=3 110 156 1.0E-11
sp|Q9QW07|PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus GN=Plcb4 PE=1 SV=2 110 156 1.0E-11
sp|P24135|PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus GN=Plcg2 PE=1 SV=1 449 666 1.0E-11
sp|Q62077|PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus GN=Plcg1 PE=1 SV=2 443 680 1.0E-11
sp|Q01970|PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens GN=PLCB3 PE=1 SV=2 106 156 1.0E-11
sp|Q99JE6|PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus GN=Plcb3 PE=1 SV=2 75 156 1.0E-11
sp|Q99JE6|PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus GN=Plcb3 PE=1 SV=2 256 351 1.0E-11
sp|P08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus GN=PLCG1 PE=1 SV=1 443 666 2.0E-11
sp|P10686|PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus GN=Plcg1 PE=1 SV=1 443 680 2.0E-11
sp|P51432|PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus GN=Plcb3 PE=1 SV=2 54 156 2.0E-11
sp|Q9LY51|PLCD7_ARATH Phosphoinositide phospholipase C 7 OS=Arabidopsis thaliana GN=PLC7 PE=1 SV=1 59 167 3.0E-11
sp|Q39033|PLCD2_ARATH Phosphoinositide phospholipase C 2 OS=Arabidopsis thaliana GN=PLC2 PE=1 SV=1 59 167 3.0E-11
sp|P25455|PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster GN=Plc21C PE=2 SV=3 256 337 3.0E-11
sp|O89040|PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus GN=Plcb2 PE=2 SV=1 105 156 5.0E-11
sp|A3KGF7|PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus GN=Plcb2 PE=1 SV=1 105 156 8.0E-11
sp|P19174|PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens GN=PLCG1 PE=1 SV=1 443 680 8.0E-11
sp|Q15111|PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens GN=PLCL1 PE=1 SV=3 84 160 9.0E-11
sp|Q00722|PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens GN=PLCB2 PE=1 SV=2 106 156 9.0E-11
sp|Q8GV43|PLCD6_ARATH Phosphoinositide phospholipase C 6 OS=Arabidopsis thaliana GN=PLC6 PE=2 SV=2 82 167 1.0E-10
sp|Q39032|PLCD1_ARATH Phosphoinositide phospholipase C 1 OS=Arabidopsis thaliana GN=PLC1 PE=2 SV=1 82 167 1.0E-10
sp|G5EBH0|PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans GN=egl-8 PE=1 SV=1 106 182 1.0E-10
sp|Q3USB7|PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus GN=Plcl1 PE=1 SV=3 59 170 2.0E-10
sp|Q62688|PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus GN=Plcl1 PE=1 SV=1 59 170 2.0E-10
sp|Q56W08|PLCD3_ARATH Phosphoinositide phospholipase C 3 OS=Arabidopsis thaliana GN=PLC3 PE=2 SV=1 82 200 1.0E-09
sp|P13217|PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster GN=norpA PE=1 SV=4 82 183 1.0E-09
sp|Q944C2|PLCD5_ARATH Phosphoinositide phospholipase C 5 OS=Arabidopsis thaliana GN=PLC5 PE=2 SV=2 81 154 1.0E-09
sp|Q944C1|PLCD4_ARATH Phosphoinositide phospholipase C 4 OS=Arabidopsis thaliana GN=PLC4 PE=2 SV=2 81 154 3.0E-09
sp|Q9STZ3|PLCD8_ARATH Phosphoinositide phospholipase C 8 OS=Arabidopsis thaliana GN=PLC8 PE=2 SV=1 263 678 9.0E-09
sp|Q6NMA7|PLCD9_ARATH Phosphoinositide phospholipase C 9 OS=Arabidopsis thaliana GN=PLC9 PE=2 SV=1 263 678 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0004435 phosphatidylinositol phospholipase C activity Yes
GO:0007165 signal transduction Yes
GO:0035556 intracellular signal transduction Yes
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0050789 regulation of biological process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0008081 phosphoric diester hydrolase activity No
GO:0003824 catalytic activity No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0004629 phospholipase C activity No
GO:0016298 lipase activity No
GO:0004620 phospholipase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4136
MIRRFKALRRRKDQSKKNMATDTPSTTTVSKETLPFLQHIFDCHAGPDKKWTRGQAKTFIRKVQLQDDSTTAATQ
LVSQPSVDLDSFLAYMSSQDCELTLPCPREDYSWPLSSYFISSSHNTYLTGNQLSSSSTTGAYTSVLRRGCRCVE
VDVWDGDDGESSSASSGDVAQRGTKLARHGSAYQKLRDRLPESLASRLQKSSLGKRWESSEDGGDKTKQNQADNV
QRNKAGGTKRDKTDGPLEERAVLEPEVAVVEPRVFHGYTLTKEVPFRDVCNAIRDSAFVASDLPLIVSLEVHCSP
PQQEAMVRIMKEAWGDMLVVGRNEMKPDGLPSPEQLRGKILVKVKYAPPPSLPSDEVQDEGLTSGDEEQAAGDQK
QREQKQQQEQEQQQQQKPKKAAAKIIQALSCLGVYTSGVSFKTWTQPEARMPTHVFSLSENKFLDHREKYGRLLF
EHNMHYLLRAYPSGLRIGSSNLDPLLFWGAGAQIVALNWQQTDEGTMLNEGMFGGTPGYVLKPPGYLPSLDSAHK
EATPVPKRVTLSLYITFLAAQAIPLPESDTVAKRFNPYIKTELHIDGCRPISSNDGATTTTAAGEAEQPRLKART
STHRGCDFGLDGQQVSFVGVGGVVPELSFVRFTVRDDEIGRDDLAAWACVRLDRLGQGYRFVRLLNWCGQETAGR
VLIKVQKTLQEEA*
Coding >OphauB2|4136
ATGATTCGCCGCTTCAAGGCGCTGAGGAGAAGAAAAGACCAGAGCAAGAAGAACATGGCTACAGACACGCCGTCC
ACCACGACGGTTAGCAAGGAGACACTCCCGTTTCTGCAGCACATTTTTGATTGCCACGCCGGCCCGGACAAGAAG
TGGACGCGCGGACAGGCCAAGACGTTTATCCGCAAGGTGCAGCTGCAAGATGACTCAACCACCGCCGCAACACAA
CTCGTCAGCCAGCCGAGCGTGGACCTGGACTCGTTTCTGGCGTACATGAGCTCGCAAGACTGTGAGCTGACGCTG
CCGTGTCCGCGCGAGGATTACTCGTGGCCGCTGTCGAGTTACTTCATTAGCTCGAGCCACAATACCTACTTGACG
GGCAACCAGCTATCCAGCTCGAGTACCACGGGCGCGTATACCAGTGTCTTGCGCAGAGGCTGTCGGTGTGTAGAG
GTGGATGTGTGGGATGGTGATGACGGAGAGAGCTCGAGCGCGTCGAGCGGCGACGTGGCGCAACGTGGCACCAAG
TTGGCGAGGCATGGTAGTGCCTATCAGAAGCTAAGGGACAGGCTGCCCGAGTCGTTGGCCTCGCGGCTGCAAAAG
TCGAGCCTGGGCAAGAGGTGGGAGAGCAGCGAAGATGGGGGCGACAAGACCAAACAAAACCAAGCCGACAATGTG
CAAAGGAATAAAGCCGGCGGCACCAAAAGGGACAAGACTGACGGCCCTCTAGAGGAGCGCGCCGTGCTGGAGCCC
GAGGTGGCTGTGGTTGAACCCCGTGTCTTTCACGGCTACACTCTTACCAAGGAGGTGCCCTTTCGCGACGTGTGC
AACGCCATTCGCGATAGCGCCTTTGTGGCCTCGGACTTGCCCCTGATTGTCAGTCTCGAGGTGCACTGCAGTCCG
CCGCAGCAAGAGGCCATGGTGCGCATCATGAAGGAAGCCTGGGGCGACATGCTGGTTGTTGGGCGCAACGAGATG
AAGCCCGACGGCCTGCCCAGCCCGGAGCAGCTGCGCGGCAAGATTCTCGTAAAGGTCAAGTATGCGCCGCCGCCG
TCACTTCCCAGCGACGAGGTGCAGGATGAAGGATTGACGAGTGGCGACGAGGAGCAGGCAGCTGGCGACCAAAAG
CAACGCGAACAAAAGCAGCAGCAGGAACAAGAGCAACAGCAGCAGCAAAAGCCCAAAAAGGCGGCTGCCAAGATT
ATCCAGGCCCTCAGCTGTTTGGGCGTCTACACATCGGGCGTTTCATTCAAGACGTGGACGCAGCCCGAGGCTCGC
ATGCCCACGCATGTTTTTTCCCTTTCCGAGAACAAGTTTCTCGACCATCGCGAAAAGTACGGCCGTCTGCTCTTT
GAGCACAATATGCACTATCTTTTGCGCGCCTATCCGTCGGGTCTGCGCATTGGCTCGTCCAATCTTGATCCGCTC
TTGTTTTGGGGCGCTGGAGCCCAGATTGTCGCCTTGAATTGGCAGCAGACGGATGAAGGCACCATGTTGAATGAG
GGCATGTTTGGGGGCACGCCGGGCTACGTCCTCAAGCCGCCAGGCTATCTCCCAAGCCTAGACTCGGCGCACAAG
GAGGCCACGCCGGTGCCCAAGAGAGTGACGCTCTCCCTGTACATCACCTTTTTAGCAGCGCAGGCCATTCCGCTA
CCAGAGTCTGACACGGTGGCCAAGCGCTTCAATCCCTACATCAAGACGGAGCTGCACATTGACGGCTGCCGTCCA
ATTTCTAGCAACGACGGCGCCACGACGACGACTGCTGCGGGCGAGGCGGAGCAGCCTCGGCTCAAGGCGCGCACC
AGCACGCACCGAGGCTGCGACTTTGGGCTCGACGGACAGCAAGTGTCGTTTGTGGGCGTGGGCGGCGTCGTGCCG
GAGCTGAGTTTTGTGCGCTTTACGGTGCGCGACGATGAGATTGGGCGGGATGACTTGGCGGCGTGGGCGTGCGTG
CGGCTGGACCGGCTGGGGCAGGGCTATCGCTTTGTGAGGTTGTTGAATTGGTGTGGACAGGAGACGGCGGGGCGG
GTCTTGATTAAAGTGCAAAAGACGCTGCAAGAAGAGGCGTAG
Transcript >OphauB2|4136
ATGATTCGCCGCTTCAAGGCGCTGAGGAGAAGAAAAGACCAGAGCAAGAAGAACATGGCTACAGACACGCCGTCC
ACCACGACGGTTAGCAAGGAGACACTCCCGTTTCTGCAGCACATTTTTGATTGCCACGCCGGCCCGGACAAGAAG
TGGACGCGCGGACAGGCCAAGACGTTTATCCGCAAGGTGCAGCTGCAAGATGACTCAACCACCGCCGCAACACAA
CTCGTCAGCCAGCCGAGCGTGGACCTGGACTCGTTTCTGGCGTACATGAGCTCGCAAGACTGTGAGCTGACGCTG
CCGTGTCCGCGCGAGGATTACTCGTGGCCGCTGTCGAGTTACTTCATTAGCTCGAGCCACAATACCTACTTGACG
GGCAACCAGCTATCCAGCTCGAGTACCACGGGCGCGTATACCAGTGTCTTGCGCAGAGGCTGTCGGTGTGTAGAG
GTGGATGTGTGGGATGGTGATGACGGAGAGAGCTCGAGCGCGTCGAGCGGCGACGTGGCGCAACGTGGCACCAAG
TTGGCGAGGCATGGTAGTGCCTATCAGAAGCTAAGGGACAGGCTGCCCGAGTCGTTGGCCTCGCGGCTGCAAAAG
TCGAGCCTGGGCAAGAGGTGGGAGAGCAGCGAAGATGGGGGCGACAAGACCAAACAAAACCAAGCCGACAATGTG
CAAAGGAATAAAGCCGGCGGCACCAAAAGGGACAAGACTGACGGCCCTCTAGAGGAGCGCGCCGTGCTGGAGCCC
GAGGTGGCTGTGGTTGAACCCCGTGTCTTTCACGGCTACACTCTTACCAAGGAGGTGCCCTTTCGCGACGTGTGC
AACGCCATTCGCGATAGCGCCTTTGTGGCCTCGGACTTGCCCCTGATTGTCAGTCTCGAGGTGCACTGCAGTCCG
CCGCAGCAAGAGGCCATGGTGCGCATCATGAAGGAAGCCTGGGGCGACATGCTGGTTGTTGGGCGCAACGAGATG
AAGCCCGACGGCCTGCCCAGCCCGGAGCAGCTGCGCGGCAAGATTCTCGTAAAGGTCAAGTATGCGCCGCCGCCG
TCACTTCCCAGCGACGAGGTGCAGGATGAAGGATTGACGAGTGGCGACGAGGAGCAGGCAGCTGGCGACCAAAAG
CAACGCGAACAAAAGCAGCAGCAGGAACAAGAGCAACAGCAGCAGCAAAAGCCCAAAAAGGCGGCTGCCAAGATT
ATCCAGGCCCTCAGCTGTTTGGGCGTCTACACATCGGGCGTTTCATTCAAGACGTGGACGCAGCCCGAGGCTCGC
ATGCCCACGCATGTTTTTTCCCTTTCCGAGAACAAGTTTCTCGACCATCGCGAAAAGTACGGCCGTCTGCTCTTT
GAGCACAATATGCACTATCTTTTGCGCGCCTATCCGTCGGGTCTGCGCATTGGCTCGTCCAATCTTGATCCGCTC
TTGTTTTGGGGCGCTGGAGCCCAGATTGTCGCCTTGAATTGGCAGCAGACGGATGAAGGCACCATGTTGAATGAG
GGCATGTTTGGGGGCACGCCGGGCTACGTCCTCAAGCCGCCAGGCTATCTCCCAAGCCTAGACTCGGCGCACAAG
GAGGCCACGCCGGTGCCCAAGAGAGTGACGCTCTCCCTGTACATCACCTTTTTAGCAGCGCAGGCCATTCCGCTA
CCAGAGTCTGACACGGTGGCCAAGCGCTTCAATCCCTACATCAAGACGGAGCTGCACATTGACGGCTGCCGTCCA
ATTTCTAGCAACGACGGCGCCACGACGACGACTGCTGCGGGCGAGGCGGAGCAGCCTCGGCTCAAGGCGCGCACC
AGCACGCACCGAGGCTGCGACTTTGGGCTCGACGGACAGCAAGTGTCGTTTGTGGGCGTGGGCGGCGTCGTGCCG
GAGCTGAGTTTTGTGCGCTTTACGGTGCGCGACGATGAGATTGGGCGGGATGACTTGGCGGCGTGGGCGTGCGTG
CGGCTGGACCGGCTGGGGCAGGGCTATCGCTTTGTGAGGTTGTTGAATTGGTGTGGACAGGAGACGGCGGGGCGG
GTCTTGATTAAAGTGCAAAAGACGCTGCAAGAAGAGGCGTAG
Gene >OphauB2|4136
ATGATTCGCCGCTTCAAGGCGCTGAGGAGAAGAAAAGACCAGAGCAAGAAGAACATGGCTACAGACACGCCGTCC
ACCACGACGGTTAGCAAGGAGACACTCCCGTTTCTGCAGCACATTTTTGATTGCCACGCCGGCCCGGACAAGAAG
TGGACGCGCGGACAGGCCAAGACGTTTATCCGCAAGGTGCAGCTGCAAGATGACTCAACCACCGCCGCAACACAA
CTCGTCAGCCAGCCGAGCGTGGACCTGGACTCGTTTCTGGCGTACATGAGCTCGCAAGACTGTGAGCTGACGCTG
CCGTGTCCGCGCGAGGATTACTCGTGGCCGCTGTCGAGTTACTTCATTAGCTCGAGCCACAATACCTACTTGACG
GGCAACCAGCTATCCAGCTCGAGTACCACGGGCGCGTATACCAGTGTCTTGCGCAGAGGCTGTCGGTGTGTAGAG
GTGGATGTGTGGGATGGTGATGACGGAGAGAGCTCGAGCGCGTCGAGCGGCGACGTGGCGCAACGTGGCACCAAG
TTGGCGAGGCATGGTAGTGCCTATCAGAAGCTAAGGGACAGGCTGCCCGAGTCGTTGGCCTCGCGGCTGCAAAAG
TCGAGCCTGGGCAAGAGGTGGGAGAGCAGCGAAGATGGGGGCGACAAGACCAAACAAAACCAAGCCGACAATGTG
CAAAGGAATAAAGCCGGCGGCACCAAAAGGGACAAGACTGACGGCCCTCTAGAGGAGCGCGCCGTGCTGGAGCCC
GAGGTGGCTGTGGTTGAACCCCGTGTCTTTCACGGCTACACTCTTACCAAGGAGGTGCCCTTTCGCGACGTGTGC
AACGCCATTCGCGATAGCGCCTTTGTGGCCTCGGACTTGCCCCTGATTGTCAGTCTCGAGGTGCACTGCAGTCCG
CCGCAGCAAGAGGCCATGGTGCGCATCATGAAGGAAGCCTGGGGCGACATGCTGGTTGTTGGGCGCAACGAGATG
AAGCCCGACGGCCTGCCCAGCCCGGAGCAGCTGCGCGGCAAGATTCTCGTAAAGGTCAAGTATGCGCCGCCGCCG
TCACTTCCCAGCGACGAGGTGCAGGATGAAGGATTGACGAGTGGCGACGAGGAGCAGGCAGCTGGCGACCAAAAG
CAACGCGAACAAAAGCAGCAGCAGGAACAAGAGCAACAGCAGCAGCAAAAGCCCAAAAAGGCGGCTGCCAAGATT
ATCCAGGCCCTCAGCTGTTTGGGCGTCTACACATCGGGCGTTTCATTCAAGACGTGGACGCAGCCCGAGGCTCGC
ATGCCCACGCATGTTTTTTCCCTTTCCGAGAACAAGTTTCTCGACCATCGCGAAAAGTACGGCCGTCTGCTCTTT
GAGCACAATATGCACTATCTTTTGCGCGCCTATCCGTCGGGTCTGCGCATTGGCTCGTCCAATCTTGATCCGCTC
TTGTTTTGGGGCGCTGGAGCCCAGATTGTCGCCTTGAATTGGCAGCAGACGGATGAAGGCACCATGTTGAATGAG
GGCATGTTTGGGGGCACGCCGGGCTACGTCCTCAAGCCGCCAGGTGAGTTTTTTGCAGCACCCTGCTTTATAAAG
ACTCTAGCGGGAGGCTTGTATTACAAGACGACGGGCATGCTAACACTGCTCAACAGGCTATCTCCCAAGCCTAGA
CTCGGCGCACAAGGAGGCCACGCCGGTGCCCAAGAGAGTGACGCTCTCCCTGTACATCACCTTTTTAGCAGCGCA
GGCCATTCCGCTACCAGAGTCTGACACGGTGGCCAAGCGCTTCAATCCCTACATCAAGACGGAGCTGCACATTGA
CGGCTGCCGTCCAATTTCTAGCAACGACGGCGCCACGACGACGACTGCTGCGGGCGAGGCGGAGCAGCCTCGGCT
CAAGGCGCGCACCAGCACGCACCGAGGCTGCGACTTTGGGCTCGACGGACAGCAAGTGTCGTTTGTGGGCGTGGG
CGGCGTCGTGCCGGAGCTGAGTTTTGTGCGCTTTACGGTGCGCGACGATGAGATTGGGCGGGATGACTTGGCGGC
GTGGGCGTGCGTGCGGCTGGACCGGCTGGGGCAGGGCTATCGCTTTGTGAGGTTGTTGAATTGGTGTGGACAGGA
GACGGCGGGGCGGGTCTTGATTAAAGTGCAAAAGACGCTGCAAGAAGAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail