Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4131
Gene name
LocationContig_27:130357..131158
Strand-
Gene length (bp)801
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04140 ICMT Isoprenylcysteine carboxyl methyltransferase (ICMT) family 1.9E-26 154 245
PF04191 PEMT Phospholipid methyltransferase 2.0E-11 147 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O12947|ICMT_XENLA Protein-S-isoprenylcysteine O-methyltransferase OS=Xenopus laevis GN=icmt PE=2 SV=1 41 265 2.0E-50
sp|O60725|ICMT_HUMAN Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens GN=ICMT PE=1 SV=1 45 265 7.0E-49
sp|Q9EQK7|ICMT_MOUSE Protein-S-isoprenylcysteine O-methyltransferase OS=Mus musculus GN=Icmt PE=2 SV=2 45 265 1.0E-48
sp|Q9WVM4|ICMT_RAT Protein-S-isoprenylcysteine O-methyltransferase (Fragment) OS=Rattus norvegicus GN=Icmt PE=1 SV=1 45 265 2.0E-48
sp|P32584|STE14_YEAST Protein-S-isoprenylcysteine O-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE14 PE=1 SV=1 54 265 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O12947|ICMT_XENLA Protein-S-isoprenylcysteine O-methyltransferase OS=Xenopus laevis GN=icmt PE=2 SV=1 41 265 2.0E-50
sp|O60725|ICMT_HUMAN Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens GN=ICMT PE=1 SV=1 45 265 7.0E-49
sp|Q9EQK7|ICMT_MOUSE Protein-S-isoprenylcysteine O-methyltransferase OS=Mus musculus GN=Icmt PE=2 SV=2 45 265 1.0E-48
sp|Q9WVM4|ICMT_RAT Protein-S-isoprenylcysteine O-methyltransferase (Fragment) OS=Rattus norvegicus GN=Icmt PE=1 SV=1 45 265 2.0E-48
sp|P32584|STE14_YEAST Protein-S-isoprenylcysteine O-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE14 PE=1 SV=1 54 265 2.0E-48
sp|P87014|MAM4_SCHPO Protein-S-isoprenylcysteine O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam4 PE=3 SV=1 43 265 3.0E-39
sp|Q558K8|ICMT_DICDI Protein-S-isoprenylcysteine O-methyltransferase OS=Dictyostelium discoideum GN=icmt-1 PE=2 SV=2 81 263 3.0E-33
sp|Q93W54|ICMTB_ARATH Protein-S-isoprenylcysteine O-methyltransferase B OS=Arabidopsis thaliana GN=ICMTB PE=1 SV=1 69 266 5.0E-31
sp|Q7XSR9|ICMT_ORYSJ Probable protein-S-isoprenylcysteine O-methyltransferase OS=Oryza sativa subsp. japonica GN=ICMT PE=3 SV=2 81 265 1.0E-29
sp|A2XX73|ICMT_ORYSI Probable protein-S-isoprenylcysteine O-methyltransferase OS=Oryza sativa subsp. indica GN=ICMT PE=3 SV=2 81 265 1.0E-29
sp|Q9FMW9|ICMTA_ARATH Protein-S-isoprenylcysteine O-methyltransferase A OS=Arabidopsis thaliana GN=ICMTA PE=1 SV=1 69 266 2.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0004671 protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity Yes
GO:0006481 C-terminal protein methylation Yes
GO:0016021 integral component of membrane Yes
GO:0043414 macromolecule methylation No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0018410 C-terminal protein amino acid modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0032259 methylation No
GO:0043687 post-translational protein modification No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0008168 methyltransferase activity No
GO:0010340 carboxyl-O-methyltransferase activity No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0006479 protein methylation No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0008213 protein alkylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0003880 protein C-terminal carboxyl O-methyltransferase activity No
GO:0016740 transferase activity No
GO:0019538 protein metabolic process No
GO:0051998 protein carboxyl O-methyltransferase activity No
GO:0008276 protein methyltransferase activity No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008171 O-methyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 73 95 22
3 115 137 22
4 144 166 22
5 210 232 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4131
MHSPVLQSATSSGSSSPSSLSLFYSPEDDVIKHFAAGQPRSLSGIALRAFCLGSAFTIGTALAIALPLLYPDTPF
WRPPFFLAALAAFHFLEFWTTAARNHTAARVDSFLLTANWPAYAIAHAAAFAECTLVGLVWPSRNWTGGAVAMWL
GFLLVLVGQAVRSAAMLHAGTSFNHQIQTRKSVSHCLVTSGVYSRLRHPSYFGFFYWSLGTQLAMGNMFCFFAYT
IVLWSFFHSRIRVEETKLIEFFGQDYVDYRKRVGTGIPFVG*
Coding >OphauB2|4131
ATGCACTCCCCAGTGCTTCAAAGCGCCACGAGCTCAGGCTCATCCTCCCCGTCGTCCCTTTCCCTCTTTTACTCG
CCCGAAGACGATGTCATCAAGCACTTTGCTGCCGGCCAGCCTCGCTCTCTGTCTGGCATTGCCCTTCGTGCCTTT
TGTCTCGGTAGCGCCTTTACCATTGGCACCGCCCTAGCCATTGCCCTGCCGCTTCTCTACCCCGACACTCCTTTC
TGGCGCCCGCCCTTTTTTCTCGCCGCGCTCGCTGCCTTTCACTTTCTCGAGTTTTGGACCACGGCCGCGCGCAAC
CATACTGCTGCGCGTGTCGACTCGTTTCTCCTCACGGCAAACTGGCCTGCATATGCCATTGCTCACGCAGCTGCT
TTTGCAGAATGTACTCTTGTCGGCCTCGTCTGGCCCTCGCGCAACTGGACGGGGGGGGCTGTTGCAATGTGGCTC
GGTTTCTTGCTGGTTCTTGTGGGCCAGGCTGTCAGATCGGCTGCCATGCTTCACGCTGGCACAAGCTTTAACCAT
CAGATCCAGACGCGCAAATCCGTGTCACATTGCCTAGTCACCTCGGGCGTTTATTCCCGTCTGCGTCATCCCAGC
TACTTTGGCTTTTTCTACTGGAGCCTGGGCACCCAGCTGGCAATGGGCAACATGTTTTGCTTCTTTGCATACACC
ATTGTCTTGTGGTCATTTTTTCACTCGCGCATCCGCGTCGAGGAGACCAAGCTTATCGAGTTTTTTGGCCAAGAC
TACGTTGATTATCGCAAAAGAGTAGGTACTGGCATCCCCTTTGTCGGCTAA
Transcript >OphauB2|4131
ATGCACTCCCCAGTGCTTCAAAGCGCCACGAGCTCAGGCTCATCCTCCCCGTCGTCCCTTTCCCTCTTTTACTCG
CCCGAAGACGATGTCATCAAGCACTTTGCTGCCGGCCAGCCTCGCTCTCTGTCTGGCATTGCCCTTCGTGCCTTT
TGTCTCGGTAGCGCCTTTACCATTGGCACCGCCCTAGCCATTGCCCTGCCGCTTCTCTACCCCGACACTCCTTTC
TGGCGCCCGCCCTTTTTTCTCGCCGCGCTCGCTGCCTTTCACTTTCTCGAGTTTTGGACCACGGCCGCGCGCAAC
CATACTGCTGCGCGTGTCGACTCGTTTCTCCTCACGGCAAACTGGCCTGCATATGCCATTGCTCACGCAGCTGCT
TTTGCAGAATGTACTCTTGTCGGCCTCGTCTGGCCCTCGCGCAACTGGACGGGGGGGGCTGTTGCAATGTGGCTC
GGTTTCTTGCTGGTTCTTGTGGGCCAGGCTGTCAGATCGGCTGCCATGCTTCACGCTGGCACAAGCTTTAACCAT
CAGATCCAGACGCGCAAATCCGTGTCACATTGCCTAGTCACCTCGGGCGTTTATTCCCGTCTGCGTCATCCCAGC
TACTTTGGCTTTTTCTACTGGAGCCTGGGCACCCAGCTGGCAATGGGCAACATGTTTTGCTTCTTTGCATACACC
ATTGTCTTGTGGTCATTTTTTCACTCGCGCATCCGCGTCGAGGAGACCAAGCTTATCGAGTTTTTTGGCCAAGAC
TACGTTGATTATCGCAAAAGAGTAGGTACTGGCATCCCCTTTGTCGGCTAA
Gene >OphauB2|4131
ATGCACTCCCCAGTGCTTCAAAGCGCCACGAGCTCAGGCTCATCCTCCCCGTCGTCCCTTTCCCTCTTTTACTCG
CCCGAAGACGATGTCATCAAGCACTTTGCTGCCGGCCAGCCTCGCTCTCTGTCTGGCATTGCCCTTCGTGCCTTT
TGTCTCGGTAGCGCCTTTACCATTGGCACCGCCCTAGCCATTGCCCTGCCGCTTCTCTACCCCGACACTCCTTTC
TGGCGCCCGCCCTTTTTTCTCGCCGCGCTCGCTGCCTTTCACTTTCTCGAGTTTTGGACCACGGCCGCGCGCAAC
CATACTGCTGCGCGTGTCGACTCGTTTCTCCTCACGGCAAACTGGCCTGCATATGCCATTGCTCACGCAGCTGCT
TTTGCAGAATGTACTCTTGTCGGCCTCGTCTGGCCCTCGCGCAACTGGACGGGGGGGGCTGTTGCAATGTGGCTC
GGTTTCTTGCTGGTTCTTGTGGGCCAGGCTGTCAGATCGGCTGCCATGCTTCACGCTGGCACAAGCTTTAACCAT
CAGATCCAGACGCGCAAATCCGTGTCACATTGCCTAGTCACCTCGGGCGTTTATTCCCGTCTGCGTCATCCCAGC
TACTTTGGCTTTTTCTACTGGAGCCTGGGCACCCAGCTGGCAATGGGCAACATGTTTTGCTTCTTTGCATACACC
ATTGTCTTGTGGTCATTTTTTCACTCGCGCATCCGCGTCGAGGAGACCAAGCTTATCGAGTTTTTTGGCCAAGAC
TACGTTGATTATCGCAAAAGAGTAGGTACTGGCATCCCCTTTGTCGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail