Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4131
Gene name
LocationContig_27:130357..131158
Strand-
Gene length (bp)801
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04140 ICMT Isoprenylcysteine carboxyl methyltransferase (ICMT) family 1.9E-26 154 245
PF04191 PEMT Phospholipid methyltransferase 2.0E-11 147 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O12947|ICMT_XENLA Protein-S-isoprenylcysteine O-methyltransferase OS=Xenopus laevis GN=icmt PE=2 SV=1 41 265 2.0E-50
sp|O60725|ICMT_HUMAN Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens GN=ICMT PE=1 SV=1 45 265 7.0E-49
sp|Q9EQK7|ICMT_MOUSE Protein-S-isoprenylcysteine O-methyltransferase OS=Mus musculus GN=Icmt PE=2 SV=2 45 265 1.0E-48
sp|Q9WVM4|ICMT_RAT Protein-S-isoprenylcysteine O-methyltransferase (Fragment) OS=Rattus norvegicus GN=Icmt PE=1 SV=1 45 265 2.0E-48
sp|P32584|STE14_YEAST Protein-S-isoprenylcysteine O-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE14 PE=1 SV=1 54 265 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O12947|ICMT_XENLA Protein-S-isoprenylcysteine O-methyltransferase OS=Xenopus laevis GN=icmt PE=2 SV=1 41 265 2.0E-50
sp|O60725|ICMT_HUMAN Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens GN=ICMT PE=1 SV=1 45 265 7.0E-49
sp|Q9EQK7|ICMT_MOUSE Protein-S-isoprenylcysteine O-methyltransferase OS=Mus musculus GN=Icmt PE=2 SV=2 45 265 1.0E-48
sp|Q9WVM4|ICMT_RAT Protein-S-isoprenylcysteine O-methyltransferase (Fragment) OS=Rattus norvegicus GN=Icmt PE=1 SV=1 45 265 2.0E-48
sp|P32584|STE14_YEAST Protein-S-isoprenylcysteine O-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE14 PE=1 SV=1 54 265 2.0E-48
sp|P87014|MAM4_SCHPO Protein-S-isoprenylcysteine O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam4 PE=3 SV=1 43 265 3.0E-39
sp|Q558K8|ICMT_DICDI Protein-S-isoprenylcysteine O-methyltransferase OS=Dictyostelium discoideum GN=icmt-1 PE=2 SV=2 81 263 3.0E-33
sp|Q93W54|ICMTB_ARATH Protein-S-isoprenylcysteine O-methyltransferase B OS=Arabidopsis thaliana GN=ICMTB PE=1 SV=1 69 266 5.0E-31
sp|Q7XSR9|ICMT_ORYSJ Probable protein-S-isoprenylcysteine O-methyltransferase OS=Oryza sativa subsp. japonica GN=ICMT PE=3 SV=2 81 265 1.0E-29
sp|A2XX73|ICMT_ORYSI Probable protein-S-isoprenylcysteine O-methyltransferase OS=Oryza sativa subsp. indica GN=ICMT PE=3 SV=2 81 265 1.0E-29
sp|Q9FMW9|ICMTA_ARATH Protein-S-isoprenylcysteine O-methyltransferase A OS=Arabidopsis thaliana GN=ICMTA PE=1 SV=1 69 266 2.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0004671 protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity Yes
GO:0006481 C-terminal protein methylation Yes
GO:0016021 integral component of membrane Yes
GO:0043414 macromolecule methylation No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0018410 C-terminal protein amino acid modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0032259 methylation No
GO:0043687 post-translational protein modification No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0008168 methyltransferase activity No
GO:0010340 carboxyl-O-methyltransferase activity No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0006479 protein methylation No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0008213 protein alkylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0003880 protein C-terminal carboxyl O-methyltransferase activity No
GO:0016740 transferase activity No
GO:0019538 protein metabolic process No
GO:0051998 protein carboxyl O-methyltransferase activity No
GO:0008276 protein methyltransferase activity No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008171 O-methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 73 95 22
3 115 137 22
4 144 166 22
5 210 232 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4192
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6547
Ophiocordyceps australis map64 (Brazil) OphauB2|4131 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07119
Ophiocordyceps camponoti-rufipedis Ophun1|3667
Ophiocordyceps kimflemingae Ophio5|6220
Ophiocordyceps subramaniannii Hirsu2|8514

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4131
MHSPVLQSATSSGSSSPSSLSLFYSPEDDVIKHFAAGQPRSLSGIALRAFCLGSAFTIGTALAIALPLLYPDTPF
WRPPFFLAALAAFHFLEFWTTAARNHTAARVDSFLLTANWPAYAIAHAAAFAECTLVGLVWPSRNWTGGAVAMWL
GFLLVLVGQAVRSAAMLHAGTSFNHQIQTRKSVSHCLVTSGVYSRLRHPSYFGFFYWSLGTQLAMGNMFCFFAYT
IVLWSFFHSRIRVEETKLIEFFGQDYVDYRKRVGTGIPFVG*
Coding >OphauB2|4131
ATGCACTCCCCAGTGCTTCAAAGCGCCACGAGCTCAGGCTCATCCTCCCCGTCGTCCCTTTCCCTCTTTTACTCG
CCCGAAGACGATGTCATCAAGCACTTTGCTGCCGGCCAGCCTCGCTCTCTGTCTGGCATTGCCCTTCGTGCCTTT
TGTCTCGGTAGCGCCTTTACCATTGGCACCGCCCTAGCCATTGCCCTGCCGCTTCTCTACCCCGACACTCCTTTC
TGGCGCCCGCCCTTTTTTCTCGCCGCGCTCGCTGCCTTTCACTTTCTCGAGTTTTGGACCACGGCCGCGCGCAAC
CATACTGCTGCGCGTGTCGACTCGTTTCTCCTCACGGCAAACTGGCCTGCATATGCCATTGCTCACGCAGCTGCT
TTTGCAGAATGTACTCTTGTCGGCCTCGTCTGGCCCTCGCGCAACTGGACGGGGGGGGCTGTTGCAATGTGGCTC
GGTTTCTTGCTGGTTCTTGTGGGCCAGGCTGTCAGATCGGCTGCCATGCTTCACGCTGGCACAAGCTTTAACCAT
CAGATCCAGACGCGCAAATCCGTGTCACATTGCCTAGTCACCTCGGGCGTTTATTCCCGTCTGCGTCATCCCAGC
TACTTTGGCTTTTTCTACTGGAGCCTGGGCACCCAGCTGGCAATGGGCAACATGTTTTGCTTCTTTGCATACACC
ATTGTCTTGTGGTCATTTTTTCACTCGCGCATCCGCGTCGAGGAGACCAAGCTTATCGAGTTTTTTGGCCAAGAC
TACGTTGATTATCGCAAAAGAGTAGGTACTGGCATCCCCTTTGTCGGCTAA
Transcript >OphauB2|4131
ATGCACTCCCCAGTGCTTCAAAGCGCCACGAGCTCAGGCTCATCCTCCCCGTCGTCCCTTTCCCTCTTTTACTCG
CCCGAAGACGATGTCATCAAGCACTTTGCTGCCGGCCAGCCTCGCTCTCTGTCTGGCATTGCCCTTCGTGCCTTT
TGTCTCGGTAGCGCCTTTACCATTGGCACCGCCCTAGCCATTGCCCTGCCGCTTCTCTACCCCGACACTCCTTTC
TGGCGCCCGCCCTTTTTTCTCGCCGCGCTCGCTGCCTTTCACTTTCTCGAGTTTTGGACCACGGCCGCGCGCAAC
CATACTGCTGCGCGTGTCGACTCGTTTCTCCTCACGGCAAACTGGCCTGCATATGCCATTGCTCACGCAGCTGCT
TTTGCAGAATGTACTCTTGTCGGCCTCGTCTGGCCCTCGCGCAACTGGACGGGGGGGGCTGTTGCAATGTGGCTC
GGTTTCTTGCTGGTTCTTGTGGGCCAGGCTGTCAGATCGGCTGCCATGCTTCACGCTGGCACAAGCTTTAACCAT
CAGATCCAGACGCGCAAATCCGTGTCACATTGCCTAGTCACCTCGGGCGTTTATTCCCGTCTGCGTCATCCCAGC
TACTTTGGCTTTTTCTACTGGAGCCTGGGCACCCAGCTGGCAATGGGCAACATGTTTTGCTTCTTTGCATACACC
ATTGTCTTGTGGTCATTTTTTCACTCGCGCATCCGCGTCGAGGAGACCAAGCTTATCGAGTTTTTTGGCCAAGAC
TACGTTGATTATCGCAAAAGAGTAGGTACTGGCATCCCCTTTGTCGGCTAA
Gene >OphauB2|4131
ATGCACTCCCCAGTGCTTCAAAGCGCCACGAGCTCAGGCTCATCCTCCCCGTCGTCCCTTTCCCTCTTTTACTCG
CCCGAAGACGATGTCATCAAGCACTTTGCTGCCGGCCAGCCTCGCTCTCTGTCTGGCATTGCCCTTCGTGCCTTT
TGTCTCGGTAGCGCCTTTACCATTGGCACCGCCCTAGCCATTGCCCTGCCGCTTCTCTACCCCGACACTCCTTTC
TGGCGCCCGCCCTTTTTTCTCGCCGCGCTCGCTGCCTTTCACTTTCTCGAGTTTTGGACCACGGCCGCGCGCAAC
CATACTGCTGCGCGTGTCGACTCGTTTCTCCTCACGGCAAACTGGCCTGCATATGCCATTGCTCACGCAGCTGCT
TTTGCAGAATGTACTCTTGTCGGCCTCGTCTGGCCCTCGCGCAACTGGACGGGGGGGGCTGTTGCAATGTGGCTC
GGTTTCTTGCTGGTTCTTGTGGGCCAGGCTGTCAGATCGGCTGCCATGCTTCACGCTGGCACAAGCTTTAACCAT
CAGATCCAGACGCGCAAATCCGTGTCACATTGCCTAGTCACCTCGGGCGTTTATTCCCGTCTGCGTCATCCCAGC
TACTTTGGCTTTTTCTACTGGAGCCTGGGCACCCAGCTGGCAATGGGCAACATGTTTTGCTTCTTTGCATACACC
ATTGTCTTGTGGTCATTTTTTCACTCGCGCATCCGCGTCGAGGAGACCAAGCTTATCGAGTTTTTTGGCCAAGAC
TACGTTGATTATCGCAAAAGAGTAGGTACTGGCATCCCCTTTGTCGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail