Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4126
Gene name
LocationContig_27:110757..112558
Strand-
Gene length (bp)1801
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04172 LrgB LrgB-like family 1.1E-15 286 469
PF04172 LrgB LrgB-like family 6.1E-06 520 566

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 38 60 22
3 77 94 17
4 104 126 22
5 219 241 22
6 251 268 17
7 280 302 22
8 345 367 22
9 380 402 22
10 437 459 22
11 518 540 22
12 555 577 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4126
MHSILDRIAGLFWVAVIYLASEVIIWGLSLALAPAKLEFFASILGMLLLFCFMTVVGWLAERSDAIYVRCIRSKV
DFINAHLGMGFLIPIVTMGEHDMLHGKDIARITGAFFTTNLVSWPGVFLLSFATLTVFHKLAEWTSRLNKPFAKT
TTTLKSLTRKIKNSILHIRRDNRQSLSTETTPANSVMASFISRPREIASVTPDVEKNSQPATSPVWDRLAIFYPT
LLSMLCMVAIGLPIAITTGDERALDGFALWFLWITNVRMMRLFKTSPLLASNKRLKSVLVTLCNPVLITTGFMMG
YTRGKAAIKGHGQLQMVIETLSKGTPLRSIWTAGVKGTIIDHNPSAYFGAGDLALSLLECGMLVWGFKLYECRRQ
LFSANGGLTVILCTLAAVGNVFGSVYISKVIGLGQPEVLAFSARCATLALAKPAVQALGGNLVVNAIVVVSNGVL
GQLILPFILDRLGVQTTETKTTTEPMLDVSSSETLVGLHPLTQRTSQDSIQEAMDRKRAENDGANDSIMTVAAGV
AIGVNGAAMGVSYLYENKSRAAPYAVLSMTVFAIVTVVLTTVDPFKGFVLSLTQA*
Coding >OphauB2|4126
ATGCACAGCATTCTCGACCGAATCGCTGGCCTATTTTGGGTTGCTGTCATTTATCTCGCCAGCGAAGTCATTATT
TGGGGTCTGAGCCTAGCTCTCGCTCCCGCAAAGCTCGAGTTTTTCGCCTCTATTCTAGGCATGTTGCTGCTATTC
TGCTTCATGACAGTGGTCGGCTGGCTGGCCGAAAGATCAGATGCAATCTATGTCAGGTGCATTAGATCAAAGGTC
GATTTCATCAATGCCCACCTCGGTATGGGCTTCCTCATACCCATTGTCACCATGGGTGAACACGATATGCTCCAT
GGCAAAGATATTGCTCGCATTACAGGAGCATTCTTCACCACCAACCTTGTCTCGTGGCCTGGCGTCTTTTTGCTA
TCGTTTGCCACTCTCACGGTATTCCACAAATTGGCAGAGTGGACCTCGCGACTCAACAAACCCTTTGCCAAAACA
ACAACCACCCTCAAGAGCTTGACGCGAAAAATCAAAAACTCCATCTTGCATATTCGAAGAGATAACCGCCAAAGC
CTGAGCACCGAGACAACCCCAGCCAACTCAGTCATGGCCTCTTTTATTTCTAGGCCTCGTGAGATTGCCTCTGTC
ACTCCTGATGTGGAAAAAAACTCCCAGCCTGCCACATCACCGGTTTGGGATAGGCTGGCCATATTCTACCCCACT
CTGCTCTCGATGCTCTGCATGGTGGCAATTGGTTTGCCAATTGCCATTACCACTGGAGATGAGAGAGCTCTCGAC
GGATTCGCCCTGTGGTTCCTGTGGATCACAAACGTCAGAATGATGCGCCTGTTCAAAACATCCCCTTTGCTGGCC
TCCAACAAACGACTCAAGAGTGTCCTGGTCACTCTTTGCAACCCTGTCCTCATCACAACTGGCTTTATGATGGGA
TACACTCGAGGCAAGGCTGCAATCAAGGGCCATGGACAATTGCAGATGGTTATTGAGACACTGAGCAAGGGTACG
CCACTCAGAAGCATCTGGACTGCAGGCGTCAAGGGCACCATTATTGACCACAACCCTTCGGCCTATTTTGGAGCT
GGAGATTTGGCCCTTTCGCTCCTCGAATGCGGAATGCTGGTTTGGGGATTCAAACTCTATGAGTGCCGTCGTCAG
CTTTTCAGCGCCAATGGAGGCCTGACAGTCATTCTCTGCACTCTGGCTGCCGTGGGCAACGTGTTTGGATCCGTC
TATATCAGCAAGGTCATTGGCCTTGGTCAGCCCGAGGTCTTGGCCTTTTCGGCGCGTTGCGCTACTCTGGCTCTC
GCTAAACCTGCGGTTCAGGCCCTCGGGGGCAATCTGGTTGTCAACGCTATTGTTGTTGTCAGCAACGGGGTCCTC
GGTCAACTCATCCTACCATTTATCCTCGACCGCCTGGGTGTTCAGACCACAGAAACAAAAACGACTACGGAACCT
ATGCTGGACGTGAGCAGCAGCGAGACGCTCGTCGGTCTTCACCCACTTACCCAAAGAACCTCCCAGGATAGTATT
CAAGAAGCCATGGATCGAAAACGGGCCGAGAATGATGGCGCCAACGACTCCATCATGACAGTCGCAGCGGGTGTG
GCTATTGGAGTCAACGGAGCTGCCATGGGGGTTTCTTACCTCTACGAAAACAAGAGCCGCGCGGCGCCTTATGCC
GTTCTTTCCATGACTGTTTTTGCCATTGTCACTGTTGTTTTAACCACTGTTGACCCATTCAAAGGCTTTGTCCTA
AGCCTGACACAGGCCTAA
Transcript >OphauB2|4126
ATGCACAGCATTCTCGACCGAATCGCTGGCCTATTTTGGGTTGCTGTCATTTATCTCGCCAGCGAAGTCATTATT
TGGGGTCTGAGCCTAGCTCTCGCTCCCGCAAAGCTCGAGTTTTTCGCCTCTATTCTAGGCATGTTGCTGCTATTC
TGCTTCATGACAGTGGTCGGCTGGCTGGCCGAAAGATCAGATGCAATCTATGTCAGGTGCATTAGATCAAAGGTC
GATTTCATCAATGCCCACCTCGGTATGGGCTTCCTCATACCCATTGTCACCATGGGTGAACACGATATGCTCCAT
GGCAAAGATATTGCTCGCATTACAGGAGCATTCTTCACCACCAACCTTGTCTCGTGGCCTGGCGTCTTTTTGCTA
TCGTTTGCCACTCTCACGGTATTCCACAAATTGGCAGAGTGGACCTCGCGACTCAACAAACCCTTTGCCAAAACA
ACAACCACCCTCAAGAGCTTGACGCGAAAAATCAAAAACTCCATCTTGCATATTCGAAGAGATAACCGCCAAAGC
CTGAGCACCGAGACAACCCCAGCCAACTCAGTCATGGCCTCTTTTATTTCTAGGCCTCGTGAGATTGCCTCTGTC
ACTCCTGATGTGGAAAAAAACTCCCAGCCTGCCACATCACCGGTTTGGGATAGGCTGGCCATATTCTACCCCACT
CTGCTCTCGATGCTCTGCATGGTGGCAATTGGTTTGCCAATTGCCATTACCACTGGAGATGAGAGAGCTCTCGAC
GGATTCGCCCTGTGGTTCCTGTGGATCACAAACGTCAGAATGATGCGCCTGTTCAAAACATCCCCTTTGCTGGCC
TCCAACAAACGACTCAAGAGTGTCCTGGTCACTCTTTGCAACCCTGTCCTCATCACAACTGGCTTTATGATGGGA
TACACTCGAGGCAAGGCTGCAATCAAGGGCCATGGACAATTGCAGATGGTTATTGAGACACTGAGCAAGGGTACG
CCACTCAGAAGCATCTGGACTGCAGGCGTCAAGGGCACCATTATTGACCACAACCCTTCGGCCTATTTTGGAGCT
GGAGATTTGGCCCTTTCGCTCCTCGAATGCGGAATGCTGGTTTGGGGATTCAAACTCTATGAGTGCCGTCGTCAG
CTTTTCAGCGCCAATGGAGGCCTGACAGTCATTCTCTGCACTCTGGCTGCCGTGGGCAACGTGTTTGGATCCGTC
TATATCAGCAAGGTCATTGGCCTTGGTCAGCCCGAGGTCTTGGCCTTTTCGGCGCGTTGCGCTACTCTGGCTCTC
GCTAAACCTGCGGTTCAGGCCCTCGGGGGCAATCTGGTTGTCAACGCTATTGTTGTTGTCAGCAACGGGGTCCTC
GGTCAACTCATCCTACCATTTATCCTCGACCGCCTGGGTGTTCAGACCACAGAAACAAAAACGACTACGGAACCT
ATGCTGGACGTGAGCAGCAGCGAGACGCTCGTCGGTCTTCACCCACTTACCCAAAGAACCTCCCAGGATAGTATT
CAAGAAGCCATGGATCGAAAACGGGCCGAGAATGATGGCGCCAACGACTCCATCATGACAGTCGCAGCGGGTGTG
GCTATTGGAGTCAACGGAGCTGCCATGGGGGTTTCTTACCTCTACGAAAACAAGAGCCGCGCGGCGCCTTATGCC
GTTCTTTCCATGACTGTTTTTGCCATTGTCACTGTTGTTTTAACCACTGTTGACCCATTCAAAGGCTTTGTCCTA
AGCCTGACACAGGCCTAA
Gene >OphauB2|4126
ATGCACAGCATTCTCGACCGAATCGCTGGCCTATTTTGGGTTGCTGTCATTTATCTCGCCAGCGAAGTCATTATT
TGGGGTCTGAGCCTAGCTCTCGCTCCCGCAAAGCTCGAGTTTTTCGCCTCTATTCTAGGCATGTTGCTGCTATTC
TGCTTCATGACAGTGGTCGGCTGGCTGGCCGAAAGATCAGATGCAATCTATGTCAGGTGCATTAGATCAAAGGTT
AGCAGCTGCCCCCTGCTCGTTGTCTTGGCAACTATTGCTAACTCTTGGAAAATAGGTCGATTTCATCAATGCCCA
CCTCGGTATGGGCTTCCTCATACCCATTGTCACCATGGGTGAACACGATATGCTCCATGGCAAAGATATTGCTCG
CATTACAGGAGCATTCTTCACCACCAACCTTGTCTCGTGGCCTGGCGTCTTTTTGCTATCGTTTGCCACTCTCAC
GGTATTCCACAAATTGGCAGAGTGGACCTCGCGACTCAACAAACCCTTTGCCAAAACAACAACCACCCTCAAGAG
CTTGACGCGAAAAATCAAAAACTCCATCTTGCATATTCGAAGAGATAACCGCCAAAGCCTGAGCACCGAGACAAC
CCCAGCCAACTCAGTCATGGCCTCTTTTATTTCTAGGCCTCGTGAGATTGCCTCTGTCACTCCTGATGTGGAAAA
AAACTCCCAGCCTGCCACATCACCGGTTTGGGATAGGCTGGCCATATTCTACCCCACTCTGCTCTCGATGCTCTG
CATGGTGGCAATTGGTTTGCCAATTGCCATTACCACTGGAGATGAGAGAGCTCTCGACGGATTCGCCCTGTGGTT
CCTGTGGATCACAAACGTCAGAATGATGCGCCTGTTCAAAACATCCCCTTTGCTGGCCTCCAACAAACGACTCAA
GAGTGTCCTGGTCACTCTTTGCAACCCTGTCCTCATCACAACTGGCTTTATGATGGGATACACTCGAGGCAAGGC
TGCAATCAAGGGCCATGGACAATTGCAGATGGTTATTGAGACACTGAGCAAGGGTACGCCACTCAGAAGCATCTG
GACTGCAGGCGTCAAGGGCACCATTATTGACCACAACCCTTCGGCCTATTTTGGAGCTGGAGATTTGGCCCTTTC
GCTCCTCGAATGCGGAATGCTGGTTTGGGGATTCAAACTCTATGAGTGCCGTCGTCAGCTTTTCAGCGCCAATGG
AGGCCTGACAGTCATTCTCTGCACTCTGGCTGCCGTGGGCAACGTGTTTGGATCCGTCTATATCAGCAAGGTCAT
TGGCCTTGGTCAGCCCGAGGTCTTGGCCTTTTCGGCGCGTTGCGCTACTCTGGCTCTCGCTAAACCTGCGGTTCA
GGCCCTCGGGGGCAATCTGGTTGTCAACGCTATTGTTGTTGTCAGCAACGGGGTCCTCGGTCAACTCATCCTACC
ATTTATCCTCGACCGCCTGGGTGTTCAGACCACAGAAACAAAAACGACTACGGAACCTATGCTGGACGTGAGCAG
CAGCGAGACGCTCGTCGGTCTTCACCCACTTACCCAAAGAACCTCCCAGGATAGTATTCAAGAAGCCATGGATCG
AAAACGGGCCGAGAATGATGGCGCCAACGACTCCATCATGACAGTCGCAGCGGGTGTGGCTATTGGAGTCAACGG
AGCTGCCATGGGGGTTTCTTACCTCTACGAAAACAAGAGCCGCGCGGCGCCTTATGCCGTTCTTTCCATGACTGT
TTTTGCCATTGTCACTGTTGTTTTAACCACTGTTGACCCATTCAAAGGCTTTGTCCTAAGCCTGACACAGGCCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail