Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4117
Gene name
LocationContig_27:86775..88140
Strand+
Gene length (bp)1365
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.5E-20 95 234
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 2.3E-15 62 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 105 240 4.0E-15
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 56 240 1.0E-13
sp|P46076|NPII_ASPOR Neutral protease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000493 PE=1 SV=2 56 240 3.0E-13
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 248 416 3.0E-13
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 107 240 7.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 105 240 4.0E-15
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 56 240 1.0E-13
sp|P46076|NPII_ASPOR Neutral protease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000493 PE=1 SV=2 56 240 3.0E-13
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 248 416 3.0E-13
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 107 240 7.0E-13
sp|C5PE18|MEP6_COCP7 Neutral protease 2 homolog MEP6 OS=Coccidioides posadasii (strain C735) GN=MEP6 PE=3 SV=1 63 236 1.0E-12
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 239 400 2.0E-12
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 45 240 2.0E-11
sp|A1DA48|NPIIA_NEOFI Neutral protease 2 homolog NFIA_031120 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_031120 PE=3 SV=1 63 331 2.0E-11
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 49 240 3.0E-11
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 63 240 4.0E-11
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 63 239 7.0E-11
sp|C5NZY5|MEP5_COCP7 Neutral protease 2 homolog MEP5 OS=Coccidioides posadasii (strain C735) GN=MEP5 PE=3 SV=2 63 236 2.0E-10
sp|E4UUX3|NPIIA_ARTGP Neutral protease 2 homolog MGYG_04094 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_04094 PE=3 SV=1 56 240 2.0E-10
sp|A1CIU4|NPIIA_ASPCL Neutral protease 2 homolog ACLA_052720 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_052720 PE=3 SV=1 107 240 4.0E-10
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 63 233 1.0E-09
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 63 239 2.0E-09
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 104 240 2.0E-09
sp|C5FPC2|NPIIC_ARTOC Probable neutral protease 2 homolog MCYG_04257 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04257 PE=3 SV=1 54 240 3.0E-09
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 107 236 5.0E-09
sp|O77788|NFM_BOVIN Neurofilament medium polypeptide OS=Bos taurus GN=NEFM PE=1 SV=3 240 337 3.0E-08
sp|C5FCA7|NPIIB_ARTOC Probable neutral protease 2 homolog MCYG_00239 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00239 PE=3 SV=1 57 240 3.0E-08
sp|C5FIT1|NPIIE_ARTOC Probable neutral protease 2 homolog MCYG_01991 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01991 PE=3 SV=1 63 233 5.0E-08
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 107 240 1.0E-07
sp|D4AXC1|NPIIE_ARTBC Probable neutral protease 2 homolog ARB_00849 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00849 PE=3 SV=1 54 233 2.0E-07
sp|C0IPP2|NPIIB_TRIRU Probable neutral protease 2 homolog B OS=Trichophyton rubrum GN=NpII-B PE=3 SV=1 58 240 2.0E-07
sp|C0IPP1|NPIIA_TRIRU Probable neutral protease 2 homolog A OS=Trichophyton rubrum GN=NpII-A PE=3 SV=1 67 240 2.0E-07
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 104 240 3.0E-07
sp|Q0UCJ2|NPIIA_PHANO Neutral protease 2 homolog SNOG_10522 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_10522 PE=3 SV=1 49 240 3.0E-07
sp|Q17060|MRJP3_APIME Major royal jelly protein 3 OS=Apis mellifera GN=MRJP3 PE=1 SV=1 336 402 4.0E-07
sp|C1G1N6|NPIIA_PARBD Neutral protease 2 homolog PADG_00776 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00776 PE=3 SV=1 87 240 1.0E-06
sp|D4DGR5|NPIIC_TRIVH Probable neutral protease 2 homolog TRV_06370 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06370 PE=3 SV=1 67 233 1.0E-06
sp|D4AM79|NPIIC_ARTBC Probable neutral protease 2 homolog ARB_04769 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04769 PE=3 SV=1 67 233 1.0E-06
sp|C0S3U8|NPIIA_PARBP Neutral protease 2 homolog PABG_02362 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02362 PE=3 SV=2 87 240 1.0E-06
sp|Q17060|MRJP3_APIME Major royal jelly protein 3 OS=Apis mellifera GN=MRJP3 PE=1 SV=1 325 384 2.0E-06
sp|D4B639|NPIID_ARTBC Probable neutral protease 2 homolog ARB_03949 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03949 PE=3 SV=1 107 233 2.0E-06
sp|C4JLQ3|NPIIA_UNCRE Neutral protease 2 homolog UREG_03761 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_03761 PE=3 SV=1 107 235 2.0E-06
sp|A6SBW7|NPIIA_BOTFB Neutral protease 2 homolog SNOG_10522 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_10098 PE=3 SV=1 107 240 2.0E-06
sp|D4D616|NPIID_TRIVH Probable neutral protease 2 homolog TRV_02539 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02539 PE=3 SV=1 107 233 3.0E-06
sp|C5FWQ2|NPIID_ARTOC Probable neutral protease 2 homolog MCYG_07155 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07155 PE=3 SV=1 107 233 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008233 peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1025
Ophiocordyceps australis 1348a (Ghana) OphauG2|5834
Ophiocordyceps australis 1348a (Ghana) OphauG2|6932
Ophiocordyceps australis map64 (Brazil) OphauB2|1528
Ophiocordyceps australis map64 (Brazil) OphauB2|158
Ophiocordyceps australis map64 (Brazil) OphauB2|408
Ophiocordyceps australis map64 (Brazil) OphauB2|4117 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4117
MKTTAALSGVILTAAAFPSVFKRAYVSTLGSELPDDFAMQVMHPPAGFLDDNDKARKRSGPSKRAAVDNSCGDQQ
QFVQSAVALCARRAQKAAAAAQDPSTSQLMLEFFKNDDEQTRSRVASVLQGVAADCGSPNGGERTNIGCGQNGGR
FYGVTHFGGGLPNPEMQLFPEFFNLAQQPVSCGHLDAGSMIVHEMTHADAHTDDFGSSYGLQVIASLSPQQNINH
ADTYAYFAQAVDIGCGVEDLRRGGAPSGTPAQDSPDGNSPNGNSPNGNSPNGNSPNRNSPNRNSPNGETNDGETE
TPTGNSPIGNSPTGNSPTGDSPFGNSPPGNSPFDNPRNGNRQNGNRQNGNLQNGNLQNGNLQNGNLQNGNFPTGN
SPFDNSRNGNLQSGNSPFANSPNGNLQTSGIESSPPQDPAAQANQEQQPSPEQNNQEAPSSALPNWVNDIVSYVV
QKTK*
Coding >OphauB2|4117
ATGAAGACGACTGCAGCTCTCAGCGGCGTCATCTTGACGGCTGCTGCCTTTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGCGAGCTCCCCGATGACTTTGCCATGCAGGTCATGCATCCCCCAGCAGGCTTCCTTGAC
GACAACGACAAAGCCCGGAAGCGGTCTGGACCGTCCAAGCGAGCCGCTGTTGACAACTCGTGCGGCGACCAGCAG
CAATTTGTGCAAAGTGCCGTGGCGCTATGCGCAAGGCGGGCTCAAAAGGCAGCAGCGGCGGCTCAGGATCCATCC
ACCAGCCAACTCATGCTTGAGTTTTTCAAAAACGACGATGAGCAGACGCGCAGCAGGGTGGCCAGTGTGCTCCAA
GGCGTGGCTGCCGACTGCGGCTCGCCCAATGGCGGCGAGAGGACCAACATTGGCTGTGGCCAGAATGGCGGCAGG
TTTTACGGCGTCACTCACTTTGGTGGGGGACTGCCCAACCCAGAAATGCAGCTTTTCCCCGAATTCTTCAACCTC
GCCCAGCAGCCTGTCTCTTGTGGCCATTTGGACGCTGGCAGCATGATTGTGCACGAGATGACGCACGCTGATGCT
CACACGGATGATTTTGGCTCAAGCTATGGCCTCCAGGTTATTGCGTCGCTTTCGCCTCAGCAGAATATCAACCAT
GCCGATACCTATGCTTATTTTGCACAGGCGGTTGATATTGGATGTGGCGTCGAGGACTTGAGGAGAGGAGGGGCG
CCTTCTGGAACGCCTGCTCAAGACTCGCCTGATGGAAACTCGCCCAATGGAAACTCGCCCAATGGAAACTCGCCT
AATGGAAACTCGCCCAATCGAAACTCGCCCAATCGAAACTCGCCCAATGGAGAGACGAATGATGGAGAGACGGAG
ACGCCCACTGGCAATTCTCCCATTGGCAACTCTCCTACTGGCAACTCTCCTACTGGCGACTCGCCCTTTGGCAAC
TCTCCTCCTGGCAACTCACCCTTTGACAACCCGCGCAATGGCAACCGGCAAAATGGCAACCGGCAAAATGGCAAC
TTGCAAAATGGAAACTTGCAAAATGGCAACCTGCAAAATGGAAACTTGCAAAATGGAAACTTTCCTACTGGCAAC
TCGCCCTTTGACAACTCGCGCAATGGAAACCTGCAGAGTGGAAATTCGCCCTTTGCAAATTCGCCCAACGGAAAC
CTGCAGACATCAGGAATTGAATCCTCACCCCCCCAGGACCCCGCTGCTCAGGCAAACCAGGAGCAGCAGCCAAGC
CCAGAGCAGAATAACCAGGAAGCCCCGTCCTCTGCTCTCCCCAACTGGGTCAACGATATCGTCTCGTACGTGGTG
CAGAAGACAAAATAG
Transcript >OphauB2|4117
ATGAAGACGACTGCAGCTCTCAGCGGCGTCATCTTGACGGCTGCTGCCTTTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGCGAGCTCCCCGATGACTTTGCCATGCAGGTCATGCATCCCCCAGCAGGCTTCCTTGAC
GACAACGACAAAGCCCGGAAGCGGTCTGGACCGTCCAAGCGAGCCGCTGTTGACAACTCGTGCGGCGACCAGCAG
CAATTTGTGCAAAGTGCCGTGGCGCTATGCGCAAGGCGGGCTCAAAAGGCAGCAGCGGCGGCTCAGGATCCATCC
ACCAGCCAACTCATGCTTGAGTTTTTCAAAAACGACGATGAGCAGACGCGCAGCAGGGTGGCCAGTGTGCTCCAA
GGCGTGGCTGCCGACTGCGGCTCGCCCAATGGCGGCGAGAGGACCAACATTGGCTGTGGCCAGAATGGCGGCAGG
TTTTACGGCGTCACTCACTTTGGTGGGGGACTGCCCAACCCAGAAATGCAGCTTTTCCCCGAATTCTTCAACCTC
GCCCAGCAGCCTGTCTCTTGTGGCCATTTGGACGCTGGCAGCATGATTGTGCACGAGATGACGCACGCTGATGCT
CACACGGATGATTTTGGCTCAAGCTATGGCCTCCAGGTTATTGCGTCGCTTTCGCCTCAGCAGAATATCAACCAT
GCCGATACCTATGCTTATTTTGCACAGGCGGTTGATATTGGATGTGGCGTCGAGGACTTGAGGAGAGGAGGGGCG
CCTTCTGGAACGCCTGCTCAAGACTCGCCTGATGGAAACTCGCCCAATGGAAACTCGCCCAATGGAAACTCGCCT
AATGGAAACTCGCCCAATCGAAACTCGCCCAATCGAAACTCGCCCAATGGAGAGACGAATGATGGAGAGACGGAG
ACGCCCACTGGCAATTCTCCCATTGGCAACTCTCCTACTGGCAACTCTCCTACTGGCGACTCGCCCTTTGGCAAC
TCTCCTCCTGGCAACTCACCCTTTGACAACCCGCGCAATGGCAACCGGCAAAATGGCAACCGGCAAAATGGCAAC
TTGCAAAATGGAAACTTGCAAAATGGCAACCTGCAAAATGGAAACTTGCAAAATGGAAACTTTCCTACTGGCAAC
TCGCCCTTTGACAACTCGCGCAATGGAAACCTGCAGAGTGGAAATTCGCCCTTTGCAAATTCGCCCAACGGAAAC
CTGCAGACATCAGGAATTGAATCCTCACCCCCCCAGGACCCCGCTGCTCAGGCAAACCAGGAGCAGCAGCCAAGC
CCAGAGCAGAATAACCAGGAAGCCCCGTCCTCTGCTCTCCCCAACTGGGTCAACGATATCGTCTCGTACGTGGTG
CAGAAGACAAAATAG
Gene >OphauB2|4117
ATGAAGACGACTGCAGCTCTCAGCGGCGTCATCTTGACGGCTGCTGCCTTTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGCGAGCTCCCCGATGACTTTGCCATGCAGGTCATGCATCCCCCAGCAGGCTTCCTTGAC
GACAACGACAAAGCCCGGAAGCGGTCTGGACCGTCCAAGCGAGCCGCTGTTGACAACTCGTGCGGCGACCAGCAG
CAATTTGTGCAAAGTGCCGTGGCGCTATGCGCAAGGCGGGCTCAAAAGGCAGCAGCGGCGGCTCAGGATCCATCC
ACCAGCCAACTCATGCTTGAGTTTTTCAAAAACGACGATGAGCAGACGCGCAGCAGGGTGGCCAGTGTGCTCCAA
GGCGTGGCTGCCGACTGCGGCTCGCCCAATGGCGGCGAGAGGACCAACATTGGCTGTGGCCAGAATGGCGGCAGG
TTTTACGGCGTCACTCACTTTGGTGGGGGACTGCCCAACCCAGAAATGCAGCTTTTCCCCGAATTCTTCAACCTC
GCCCAGCAGCCTGTCTCTTGTGGCCATTTGGACGCTGGCAGCATGATTGTGCACGAGATGACGCACGCTGATGCT
CACACGGATGATTTTGGCTCAAGCTATGGCCTCCAGGTTATTGCGTCGCTTTCGCCTCAGCAGAATATCAACCAT
GCCGATACCTATGCTTATTTTGCACAGGCGGTTGATATTGGATGTGGCGTCGAGGACTTGAGGAGAGGAGGGGCG
CCTTCTGGAACGCCTGCTCAAGACTCGCCTGATGGAAACTCGCCCAATGGAAACTCGCCCAATGGAAACTCGCCT
AATGGAAACTCGCCCAATCGAAACTCGCCCAATCGAAACTCGCCCAATGGAGAGACGAATGATGGAGAGACGGAG
ACGCCCACTGGCAATTCTCCCATTGGCAACTCTCCTACTGGCAACTCTCCTACTGGCGACTCGCCCTTTGGCAAC
TCTCCTCCTGGCAACTCACCCTTTGACAACCCGCGCAATGGCAACCGGCAAAATGGCAACCGGCAAAATGGCAAC
TTGCAAAATGGAAACTTGCAAAATGGCAACCTGCAAAATGGAAACTTGCAAAATGGAAACTTTCCTACTGGCAAC
TCGCCCTTTGACAACTCGCGCAATGGAAACCTGCAGAGTGGAAATTCGCCCTTTGCAAATTCGCCCAACGGAAAC
CTGCAGACATCAGGAATTGAATCCTCACCCCCCCAGGACCCCGCTGCTCAGGCAAACCAGGAGCAGCAGCCAAGC
CCAGAGCAGAATAACCAGGAAGCCCCGTCCTCTGCTCTCCCCAACTGGGTCAACGATATCGTCTCGTACGTGGTG
CAGAAGACAAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail