Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4105
Gene name
LocationContig_27:54663..56111
Strand+
Gene length (bp)1448
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01733 Nucleoside_tran Nucleoside transporter 2.0E-38 151 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31381|FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN26 PE=1 SV=1 42 456 8.0E-41
sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=1 SV=3 29 456 7.0E-22
sp|Q8VXY7|ENT1_ARATH Equilibrative nucleotide transporter 1 OS=Arabidopsis thaliana GN=ENT1 PE=1 SV=1 21 455 1.0E-16
sp|Q14542|S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens GN=SLC29A2 PE=1 SV=3 47 456 1.0E-16
sp|Q9JIM1|S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus GN=Slc29a1 PE=1 SV=3 29 456 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31381|FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN26 PE=1 SV=1 42 456 8.0E-41
sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=1 SV=3 29 456 7.0E-22
sp|Q8VXY7|ENT1_ARATH Equilibrative nucleotide transporter 1 OS=Arabidopsis thaliana GN=ENT1 PE=1 SV=1 21 455 1.0E-16
sp|Q14542|S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens GN=SLC29A2 PE=1 SV=3 47 456 1.0E-16
sp|Q9JIM1|S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus GN=Slc29a1 PE=1 SV=3 29 456 1.0E-15
sp|Q944P0|ENT7_ARATH Equilibrative nucleotide transporter 7 OS=Arabidopsis thaliana GN=ENT7 PE=1 SV=1 46 454 2.0E-15
sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens GN=SLC29A1 PE=1 SV=3 29 456 1.0E-14
sp|A1A4N1|S29A3_BOVIN Equilibrative nucleoside transporter 3 OS=Bos taurus GN=SLC29A3 PE=2 SV=1 27 455 1.0E-14
sp|Q84XI3|ENT8_ARATH Equilibrative nucleotide transporter 8 OS=Arabidopsis thaliana GN=ETN8 PE=2 SV=1 44 456 2.0E-14
sp|Q9BZD2|S29A3_HUMAN Equilibrative nucleoside transporter 3 OS=Homo sapiens GN=SLC29A3 PE=1 SV=3 44 455 3.0E-13
sp|O54699|S29A2_RAT Equilibrative nucleoside transporter 2 OS=Rattus norvegicus GN=Slc29a2 PE=2 SV=1 47 456 4.0E-12
sp|Q61672|S29A2_MOUSE Equilibrative nucleoside transporter 2 OS=Mus musculus GN=Slc29a2 PE=1 SV=2 47 456 1.0E-11
sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus GN=Slc29a3 PE=1 SV=2 44 452 2.0E-11
sp|Q99P65|S29A3_MOUSE Equilibrative nucleoside transporter 3 OS=Mus musculus GN=Slc29a3 PE=1 SV=1 44 452 3.0E-11
sp|A1L272|S29A4_DANRE Equilibrative nucleoside transporter 4 OS=Danio rerio GN=slc29a4 PE=2 SV=1 51 457 5.0E-09
sp|Q944N8|ENT6_ARATH Equilibrative nucleotide transporter 6 OS=Arabidopsis thaliana GN=ENT6 PE=1 SV=1 34 451 3.0E-08
sp|Q9M0Y3|ENT3_ARATH Equilibrative nucleotide transporter 3 OS=Arabidopsis thaliana GN=ENT3 PE=1 SV=1 30 451 2.0E-07
sp|Q7RTT9|S29A4_HUMAN Equilibrative nucleoside transporter 4 OS=Homo sapiens GN=SLC29A4 PE=1 SV=1 274 456 3.0E-07
sp|Q8R139|S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus GN=Slc29a4 PE=1 SV=1 274 456 6.0E-07
sp|Q9M0Y2|ENT4_ARATH Equilibrative nucleotide transporter 4 OS=Arabidopsis thaliana GN=ENT4 PE=1 SV=1 46 453 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005337 nucleoside transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:1901642 nucleoside transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No
GO:0015858 nucleoside transport No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0071705 nitrogen compound transport No
GO:0055085 transmembrane transport No
GO:0009987 cellular process No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:1901264 carbohydrate derivative transport No
GO:0015931 nucleobase-containing compound transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 79 101 22
3 114 136 22
4 146 168 22
5 181 203 22
6 231 253 22
7 295 317 22
8 367 389 22
9 401 423 22
10 438 460 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4105
MESRPSPAADYEPIPSADVDQDSSPRRPSASRSQHQIPFSWLEYSIFCFLGIAMLWAWNMFLAAAPYFASRFADN
AWIHANFQSAILTISTLTNLAAMLLLTHVQRNASYPFRINLALMMNAVIFSLLTASTALFLNSGPGSYFAFVLVI
VACASWATGLLQNGAFAFAGSFGRPEYMQAVMAGQGIAGVLPSIAQVAAVLIFPPLQRDHTDAGPPPGGKENGAQ
RAEKSAFVYFLAAVVISVAALLALIPLVQRHKRIVASRAAAYAADAATELQDAQPAPRKRVALRHLFGKLRWLAL
GIALTFAVTMFFPVFTAKIFSIRDAAHATPIYRPAAFVPLAFTFWNVGDLGGRIISVMPTPVDQRPLVLFLLAIC
RTAHLPLYLLCNIGGRGAVVKSDWFYLIVVQLFMGLTNGWLGSTIMMAAGDWVDQSEREASGSFMGLFLVIGLSA
GSLLSFSVAGV*
Coding >OphauB2|4105
ATGGAGAGCCGTCCGTCGCCCGCGGCCGACTATGAGCCAATACCAAGCGCTGATGTTGACCAAGACTCTTCGCCC
CGTCGGCCCTCTGCCAGCCGCAGCCAGCACCAGATTCCCTTTTCATGGCTCGAGTACTCCATCTTTTGCTTCCTG
GGCATCGCCATGCTCTGGGCCTGGAACATGTTTCTTGCCGCGGCGCCCTACTTTGCCTCGCGCTTTGCAGACAAC
GCCTGGATCCACGCCAACTTTCAGTCGGCCATTCTAACCATTTCCACCTTGACAAACTTGGCTGCCATGCTGCTC
CTGACCCATGTGCAGCGCAACGCCTCGTATCCCTTTCGCATCAACCTCGCCCTCATGATGAATGCCGTCATCTTT
TCCCTCCTCACTGCCTCGACGGCCTTATTTCTCAACTCGGGGCCTGGCTCCTACTTTGCCTTTGTCCTCGTCATT
GTTGCCTGTGCCTCTTGGGCTACTGGCCTCCTCCAAAACGGCGCCTTTGCCTTTGCCGGGAGCTTTGGTCGCCCC
GAGTACATGCAGGCCGTCATGGCTGGCCAGGGAATCGCTGGCGTGCTGCCCTCGATTGCCCAGGTTGCAGCAGTC
CTCATCTTTCCGCCGCTACAGCGTGACCACACCGACGCGGGCCCACCCCCCGGCGGCAAGGAAAATGGGGCTCAA
CGGGCCGAAAAGTCGGCCTTTGTCTACTTCCTCGCCGCCGTTGTCATCTCCGTGGCGGCCTTGCTGGCCCTGATT
CCTCTGGTGCAGAGACACAAGCGCATCGTTGCCAGCCGCGCAGCTGCGTATGCCGCCGATGCAGCCACTGAACTG
CAAGATGCTCAGCCCGCGCCACGCAAGAGAGTTGCGCTGCGCCATCTCTTTGGCAAGCTCCGCTGGCTCGCGCTC
GGCATTGCTCTGACCTTTGCCGTCACAATGTTCTTTCCCGTCTTTACCGCAAAGATTTTTTCAATACGCGATGCC
GCTCATGCCACTCCTATATATCGCCCTGCTGCCTTTGTGCCTCTTGCCTTTACCTTTTGGAACGTGGGCGATCTT
GGCGGGCGCATCATCTCTGTCATGCCCACGCCTGTTGACCAAAGACCTCTGGTCCTCTTTTTGCTCGCCATTTGC
CGCACTGCACATTTACCTCTTTACCTACTCTGCAACATTGGCGGCCGTGGCGCCGTGGTCAAGAGTGACTGGTTC
TACCTCATTGTTGTTCAGCTCTTCATGGGCTTGACCAATGGCTGGCTGGGCTCGACAATCATGATGGCCGCCGGC
GATTGGGTCGACCAAAGCGAGCGAGAAGCATCGGGTAGCTTCATGGGTCTTTTCCTCGTCATTGGTCTGTCGGCC
GGCAGCTTACTGAGCTTCAGCGTGGCGGGCGTATAG
Transcript >OphauB2|4105
ATGGAGAGCCGTCCGTCGCCCGCGGCCGACTATGAGCCAATACCAAGCGCTGATGTTGACCAAGACTCTTCGCCC
CGTCGGCCCTCTGCCAGCCGCAGCCAGCACCAGATTCCCTTTTCATGGCTCGAGTACTCCATCTTTTGCTTCCTG
GGCATCGCCATGCTCTGGGCCTGGAACATGTTTCTTGCCGCGGCGCCCTACTTTGCCTCGCGCTTTGCAGACAAC
GCCTGGATCCACGCCAACTTTCAGTCGGCCATTCTAACCATTTCCACCTTGACAAACTTGGCTGCCATGCTGCTC
CTGACCCATGTGCAGCGCAACGCCTCGTATCCCTTTCGCATCAACCTCGCCCTCATGATGAATGCCGTCATCTTT
TCCCTCCTCACTGCCTCGACGGCCTTATTTCTCAACTCGGGGCCTGGCTCCTACTTTGCCTTTGTCCTCGTCATT
GTTGCCTGTGCCTCTTGGGCTACTGGCCTCCTCCAAAACGGCGCCTTTGCCTTTGCCGGGAGCTTTGGTCGCCCC
GAGTACATGCAGGCCGTCATGGCTGGCCAGGGAATCGCTGGCGTGCTGCCCTCGATTGCCCAGGTTGCAGCAGTC
CTCATCTTTCCGCCGCTACAGCGTGACCACACCGACGCGGGCCCACCCCCCGGCGGCAAGGAAAATGGGGCTCAA
CGGGCCGAAAAGTCGGCCTTTGTCTACTTCCTCGCCGCCGTTGTCATCTCCGTGGCGGCCTTGCTGGCCCTGATT
CCTCTGGTGCAGAGACACAAGCGCATCGTTGCCAGCCGCGCAGCTGCGTATGCCGCCGATGCAGCCACTGAACTG
CAAGATGCTCAGCCCGCGCCACGCAAGAGAGTTGCGCTGCGCCATCTCTTTGGCAAGCTCCGCTGGCTCGCGCTC
GGCATTGCTCTGACCTTTGCCGTCACAATGTTCTTTCCCGTCTTTACCGCAAAGATTTTTTCAATACGCGATGCC
GCTCATGCCACTCCTATATATCGCCCTGCTGCCTTTGTGCCTCTTGCCTTTACCTTTTGGAACGTGGGCGATCTT
GGCGGGCGCATCATCTCTGTCATGCCCACGCCTGTTGACCAAAGACCTCTGGTCCTCTTTTTGCTCGCCATTTGC
CGCACTGCACATTTACCTCTTTACCTACTCTGCAACATTGGCGGCCGTGGCGCCGTGGTCAAGAGTGACTGGTTC
TACCTCATTGTTGTTCAGCTCTTCATGGGCTTGACCAATGGCTGGCTGGGCTCGACAATCATGATGGCCGCCGGC
GATTGGGTCGACCAAAGCGAGCGAGAAGCATCGGGTAGCTTCATGGGTCTTTTCCTCGTCATTGGTCTGTCGGCC
GGCAGCTTACTGAGCTTCAGCGTGGCGGGCGTATAG
Gene >OphauB2|4105
ATGGAGAGCCGTCCGTCGCCCGCGGCCGACTATGAGCCAATACCAAGCGCTGATGTTGACCAAGACTCTTCGCCC
CGTCGGCCCTCTGCCAGCCGCAGCCAGCACCAGATTCCCTTTTCATGGCTCGAGTACTCCATCTTTTGCTTCCTG
GGCATCGCCATGCTCTGGGCCTGGTGCGTGCTGCCCGTGTCGTCTGTGAGATTGGGCATGGGCCCTGTTCTGACG
GGACGCCTAGGAACATGTTTCTTGCCGCGGCGCCCTACTTTGCCTCGCGCTTTGCAGACAACGCCTGGATCCACG
CCAACTTTCAGTCGGCCATTCTAACCATTTCCACCTTGACAAACTTGGCTGCCATGCTGCTCCTGACCCATGTGC
AGCGCAACGCCTCGTATCCCTTTCGCATCAACCTCGCCCTCATGATGAATGCCGTCATCTTTTCCCTCCTCACTG
CCTCGACGGCCTTATTTCTCAACTCGGGGCCTGGCTCCTACTTTGCCTTTGTCCTCGTCATTGTTGCCTGTGCCT
CTTGGGCTACTGGCCTCCTCCAAAACGGCGCCTTTGCCTTTGCCGGGAGCTTTGGTCGCCCCGAGTACATGCAGG
CCGTCATGGCTGGCCAGGGAATCGCTGGCGTGCTGCCCTCGATTGCCCAGGTTGCAGCAGTCCTCATCTTTCCGC
CGCTACAGCGTGACCACACCGACGCGGGCCCACCCCCCGGCGGCAAGGAAAATGGGGCTCAACGGGCCGAAAAGT
CGGCCTTTGTCTACTTCCTCGCCGCCGTTGTCATCTCCGTGGCGGCCTTGCTGGCCCTGATTCCTCTGGTGCAGA
GACACAAGCGCATCGTTGCCAGCCGCGCAGCTGCGTATGCCGCCGATGCAGCCACTGAACTGCAAGATGCTCAGC
CCGCGCCACGCAAGAGAGTTGCGCTGCGCCATCTCTTTGGCAAGCTCCGCTGGCTCGCGCTCGGCATTGCTCTGA
CCTTTGCCGTCACAATGTTCTTTCCCGTCTTTACCGCAAAGATTTTTTCAATACGCGATGCCGCTCATGCCACTC
CTATATATCGCCCTGCTGCCTTTGTGCCTCTTGCCTTTACCTTTTGGAACGTGGGCGATCTTGGCGGGCGCATCA
TCTCTGTCATGCCCACGCCTGTTGACCAAAGACCTCTGGTCCTCTTTTTGCTCGCCATTTGCCGCACTGCACATT
TACCTCTTTACCTACTCTGCAACATTGGCGGCCGTGGCGCCGTGGTCAAGAGTGACTGGTTCTACCTCATTGTTG
TTCAGCTCTTCATGGGCTTGACCAATGGCTGGCTGGGCTCGACAATCATGATGGCCGCCGGCGATTGGGTCGACC
AAAGCGAGCGAGAAGCATCGGGTAGCTTCATGGGTCTTTTCCTCGTCATTGGTCTGTCGGCCGGCAGCTTACTGA
GCTTCAGCGTGGCGGGCGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail