Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4099
Gene name
LocationContig_27:32110..33634
Strand+
Gene length (bp)1524
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 8.3E-06 8 41
PF00106 adh_short short chain dehydrogenase 2.3E-14 59 221
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.9E-13 63 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 1 311 3.0E-40
sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 1 312 3.0E-37
sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 1 293 4.0E-37
sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 1 293 5.0E-36
sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 1 293 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 1 311 3.0E-40
sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 1 312 3.0E-37
sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 1 293 4.0E-37
sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 1 293 5.0E-36
sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 1 293 1.0E-35
sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=1 SV=1 1 314 2.0E-35
sp|Q4V8F9|HSDL2_RAT Hydroxysteroid dehydrogenase-like protein 2 OS=Rattus norvegicus GN=Hsdl2 PE=2 SV=1 1 314 4.0E-35
sp|Q6P5L8|HSDL2_DANRE Hydroxysteroid dehydrogenase-like protein 2 OS=Danio rerio GN=hsdl2 PE=2 SV=1 10 293 6.0E-34
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 8 223 6.0E-14
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 8 213 1.0E-12
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 9 206 1.0E-12
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 1 149 5.0E-12
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 8 213 9.0E-12
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 1 277 3.0E-11
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 1 277 3.0E-11
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 8 223 6.0E-11
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 8 223 6.0E-11
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 5 210 1.0E-10
sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 7 212 1.0E-10
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 8 224 2.0E-10
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 1 261 3.0E-10
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 1 261 3.0E-10
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 7 206 4.0E-10
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 7 206 4.0E-10
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 1 277 5.0E-10
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 1 277 5.0E-10
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 1 277 5.0E-10
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 8 211 6.0E-10
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 7 146 7.0E-10
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 1 216 8.0E-10
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 7 206 2.0E-09
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 1 261 2.0E-09
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 8 263 3.0E-09
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 6 246 3.0E-09
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 9 210 3.0E-09
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 9 210 3.0E-09
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 9 210 3.0E-09
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 9 210 3.0E-09
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 9 210 3.0E-09
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 9 210 3.0E-09
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 8 206 4.0E-09
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 7 145 6.0E-09
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 8 135 6.0E-09
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 7 210 7.0E-09
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 6 147 8.0E-09
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 1 210 9.0E-09
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 1 210 9.0E-09
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 7 146 9.0E-09
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 1 210 1.0E-08
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 1 210 1.0E-08
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 5 210 2.0E-08
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 1 205 3.0E-08
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 8 205 3.0E-08
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 7 145 3.0E-08
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 8 210 4.0E-08
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 1 212 4.0E-08
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 1 212 4.0E-08
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 7 210 4.0E-08
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 7 222 4.0E-08
sp|Q96LJ7|DHRS1_HUMAN Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 3 222 5.0E-08
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 1 212 5.0E-08
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 10 133 5.0E-08
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 7 205 5.0E-08
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 9 210 1.0E-07
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 9 210 1.0E-07
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 8 140 1.0E-07
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 9 133 1.0E-07
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1 212 1.0E-07
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 7 223 2.0E-07
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 8 210 2.0E-07
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 8 221 2.0E-07
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 7 223 2.0E-07
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 1 212 3.0E-07
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 11 222 3.0E-07
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 11 222 3.0E-07
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 11 222 3.0E-07
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 1 217 3.0E-07
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 7 206 4.0E-07
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 8 133 4.0E-07
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 8 209 5.0E-07
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 6 147 5.0E-07
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 7 210 6.0E-07
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 7 210 6.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 7 206 6.0E-07
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 7 130 7.0E-07
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 7 147 7.0E-07
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 7 147 7.0E-07
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 1 108 9.0E-07
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 3 145 1.0E-06
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 3 145 1.0E-06
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 7 149 1.0E-06
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 7 212 1.0E-06
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 8 273 3.0E-06
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 7 210 4.0E-06
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 7 210 4.0E-06
sp|Q9JIF5|PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1 20 210 5.0E-06
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 36 205 7.0E-06
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 8 273 7.0E-06
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 7 147 8.0E-06
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 8 210 8.0E-06
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 6 222 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4099
MPPSTKPVALVVGASRGIGRQVAIDLARSGYAVVVAAKSISNPDAAPFPPDPNSPASTISTVTREITLAGGEATP
LVVDVRSPESVEALVSATISTYSRLDVVIYNSGAIFWAPVSKTPLRRFQLMQRVNPEGLYAVVQAALPHLSRASF
TPPCPAFLQSSPPAPSAGRIVVISPPIYSRFFRGKTAYAMGKVGMSVLTKGLAMDLEREGRSDMAVTSLWPASAI
QSAATAQFTSSSPSELAHLRNPSIFSHAILAILAAPAPAVNGHLLLDEDFLRQHIGITDLSPYNVVPGSSPRRIM
PKVLPDLRVAEQDDEGRRVDSTAISKL*
Coding >OphauB2|4099
ATGCCGCCCTCAACCAAGCCCGTTGCCCTCGTAGTCGGAGCTTCCCGCGGCATTGGCCGCCAAGTCGCCATTGAC
CTTGCCCGCAGCGGCTACGCAGTCGTCGTGGCGGCAAAGAGTATTAGCAATCCCGATGCTGCGCCTTTTCCGCCA
GATCCAAACTCGCCTGCTTCCACCATTTCCACCGTGACGCGTGAAATCACCTTGGCCGGCGGCGAGGCAACGCCC
CTTGTGGTTGATGTGCGCTCTCCCGAGAGTGTTGAAGCTCTAGTCTCAGCCACGATATCTACCTACTCCCGTCTC
GACGTCGTCATCTACAACTCTGGCGCCATCTTTTGGGCCCCCGTCTCCAAAACCCCCCTTCGCCGCTTCCAGCTC
ATGCAGCGCGTCAACCCAGAGGGCCTCTACGCCGTCGTCCAGGCCGCCCTGCCCCATCTCTCCCGCGCCTCCTTT
ACTCCGCCCTGCCCTGCGTTTTTGCAGTCGTCGCCGCCCGCCCCGTCGGCTGGCCGCATCGTCGTCATTAGTCCG
CCCATTTACAGCCGCTTCTTCCGCGGCAAGACGGCCTACGCCATGGGAAAGGTGGGCATGAGCGTCCTCACAAAG
GGGCTGGCCATGGACTTGGAGCGAGAGGGCCGCTCCGACATGGCTGTCACTAGTCTGTGGCCTGCTAGTGCCATC
CAATCCGCCGCCACCGCCCAATTCACCTCCTCCTCCCCCTCCGAACTCGCCCACCTCCGCAACCCATCCATCTTC
TCCCACGCCATCCTCGCCATCCTCGCCGCCCCCGCCCCTGCTGTCAATGGCCACCTCCTCCTCGACGAAGACTTT
CTCCGCCAGCACATTGGCATCACCGACCTCTCCCCATACAACGTCGTCCCTGGTTCCAGCCCCCGCCGCATCATG
CCAAAGGTCTTGCCCGACTTGCGCGTCGCCGAGCAAGACGACGAGGGCCGCCGCGTCGATAGCACTGCCATTTCA
AAACTCTAA
Transcript >OphauB2|4099
ATGCCGCCCTCAACCAAGCCCGTTGCCCTCGTAGTCGGAGCTTCCCGCGGCATTGGCCGCCAAGTCGCCATTGAC
CTTGCCCGCAGCGGCTACGCAGTCGTCGTGGCGGCAAAGAGTATTAGCAATCCCGATGCTGCGCCTTTTCCGCCA
GATCCAAACTCGCCTGCTTCCACCATTTCCACCGTGACGCGTGAAATCACCTTGGCCGGCGGCGAGGCAACGCCC
CTTGTGGTTGATGTGCGCTCTCCCGAGAGTGTTGAAGCTCTAGTCTCAGCCACGATATCTACCTACTCCCGTCTC
GACGTCGTCATCTACAACTCTGGCGCCATCTTTTGGGCCCCCGTCTCCAAAACCCCCCTTCGCCGCTTCCAGCTC
ATGCAGCGCGTCAACCCAGAGGGCCTCTACGCCGTCGTCCAGGCCGCCCTGCCCCATCTCTCCCGCGCCTCCTTT
ACTCCGCCCTGCCCTGCGTTTTTGCAGTCGTCGCCGCCCGCCCCGTCGGCTGGCCGCATCGTCGTCATTAGTCCG
CCCATTTACAGCCGCTTCTTCCGCGGCAAGACGGCCTACGCCATGGGAAAGGTGGGCATGAGCGTCCTCACAAAG
GGGCTGGCCATGGACTTGGAGCGAGAGGGCCGCTCCGACATGGCTGTCACTAGTCTGTGGCCTGCTAGTGCCATC
CAATCCGCCGCCACCGCCCAATTCACCTCCTCCTCCCCCTCCGAACTCGCCCACCTCCGCAACCCATCCATCTTC
TCCCACGCCATCCTCGCCATCCTCGCCGCCCCCGCCCCTGCTGTCAATGGCCACCTCCTCCTCGACGAAGACTTT
CTCCGCCAGCACATTGGCATCACCGACCTCTCCCCATACAACGTCGTCCCTGGTTCCAGCCCCCGCCGCATCATG
CCAAAGGTCTTGCCCGACTTGCGCGTCGCCGAGCAAGACGACGAGGGCCGCCGCGTCGATAGCACTGCCATTTCA
AAACTCTAA
Gene >OphauB2|4099
ATGCCGCCCTCAACCAAGCCCGTTGCCCTCGTAGTCGGAGCTTCCCGCGGCATTGGCCGCCAAGTCGCCATTGAC
CTTGCCCGCAGCGGCTACGCAGGTATTATCTACCTCCCCAAAAAATAAAGGGCTCGTCGACTTTGTCCTGCCTGC
TCACACTTGCTTCTAGTCGTCGTGGCGGCAAAGAGTATTAGCAATCCCGATGCTGCGCCTTTTCCGCCAGATCCA
AACTCGCCTGCTTCCACCATTTCCACCGTGACGCGTGAAATCACCTTGGCCGGCGGCGAGGCAACGCCCCTTGTG
GTTGATGTGCGCTCTCCCGAGAGTGTTGAAGCTCTAGTCTCAGCCACGATATCTGTATAGTCTCTTTTCCCCCCC
TTTTACCTTTTTTACCTTTTTCTCCAATCCTCTTCTTACTGCCTTTTTCATCCACCTCGTCTTACCATCGTCTTA
CCATCTCTCTCTTCTTACTGCCTTTTTCATCCATCTCCTACTACCCTTTCTCATCCACCTCCTCTCACCACTCTT
ACACCACTCCCACAGACCTACTCCCGTCTCGACGTCGTCATCTACAACTCTGGCGCCATCTTTTGGGCCCCCGTC
TCCAAAACCCCCCTTCGCCGCTTCCAGCTCATGCAGCGCGTCAACCCAGAGGGCCTCTACGCCGTCGTCCAGGCC
GCCCTGCCCCATCTCTCCCGCGCCTCCTTTACTCCGCCCTGCCCTGCGTTTTTGCAGTCGTCGCCGCCCGCCCCG
TCGGCTGGCCGCATCGTCGTCATTAGTCCGCCCATTTACAGCCGCTTCTTCCGCGGCAAGACGGCCTACGCCATG
GGAAAGGTGGGCATGAGCGTCCTCACAAAGGGGCTGGCCATGGACTTGGAGCGAGAGGGCCGCTCCGACATGGCT
GTCACTAGTCTGTGGCCTGCTAGTGTAAGTCGATTTCTTCCTCATCAAGTCTCTCTATTCCATCACCTCTTTCAC
CAAGACTCTACTTGTACCATTTTCTCCTCATCACCTCTCTACTCCACCACTCCTCTCACCAATACTCTACCCACA
CCACCACCTCTCTCATCACGCCTCTACTCCACCACTTCTCCCTCTCCCAAGTCTCTACTCCTCCACCCCCCTCAT
CACGTCTCTACCCACACCACCACCTCTCTCACCACCCCTCTATTCCACCACTTTTCCCTCTCCCCTTCTAACCTC
CCCCCTCAGGCCATCCAATCCGCCGCCACCGCCCAATTCACCTCCTCCTCCCCCTCCGAACTCGCCCACCTCCGC
AACCCATCCATCTTCTCCCACGCCATCCTCGCCATCCTCGCCGCCCCCGCCCCTGCTGTCAATGGCCACCTCCTC
CTCGACGAAGACTTTCTCCGCCAGCACATTGGCATCACCGACCTCTCCCCATACAACGTCGTCCCTGGTTCCAGC
CCCCGCCGCATCATGCCAAAGGTCTTGCCCGACTTGCGCGTCGCCGAGCAAGACGACGAGGGCCGCCGCGTCGAT
AGCACTGCCATTTCAAAACTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail