Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4098
Gene name
LocationContig_27:30712..31758
Strand-
Gene length (bp)1046
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01323 DSBA DSBA-like thioredoxin domain 2.2E-19 6 211

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09652|GSTK1_CAEEL Glutathione S-transferase kappa 1 OS=Caenorhabditis elegans GN=gstk-1 PE=3 SV=1 5 211 7.0E-22
sp|Q9Y2Q3|GSTK1_HUMAN Glutathione S-transferase kappa 1 OS=Homo sapiens GN=GSTK1 PE=1 SV=3 6 216 5.0E-14
sp|Q18973|GSTK2_CAEEL Glutathione s-transferase kappa 2 OS=Caenorhabditis elegans GN=gstk-2 PE=2 SV=1 6 219 3.0E-10
sp|P24473|GSTK1_RAT Glutathione S-transferase kappa 1 OS=Rattus norvegicus GN=Gstk1 PE=1 SV=3 6 216 2.0E-09
sp|Q9DCM2|GSTK1_MOUSE Glutathione S-transferase kappa 1 OS=Mus musculus GN=Gstk1 PE=1 SV=3 6 229 2.0E-09

GO

GO Term Description Terminal node
GO:0015035 protein disulfide oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0015036 disulfide oxidoreductase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4098
MAGGRIDCYFDIVSPYAYVAVVRLLRDLDTLTAYGVVVDFHPMFLGAIMNASGNKPPWTLPAKALYLAHDRERST
AAVGITCGSPSNLFELAKTQSPLRALLAIKATYPPSIYTATILHLFRFFWTPPHRPLANDAVLQDALAGVQVNGK
RVFDAAQVAHIMQAREEYKQTLVDEVQSAREKGAFGAPWLWVTNAKGESQPFFGSDRFNQVFRFLGLDFHDVELL
PPSAKL*
Coding >OphauB2|4098
ATGGCGGGCGGACGAATCGACTGCTACTTTGACATTGTGTCGCCGTATGCGTACGTTGCAGTGGTGCGGCTGCTG
CGCGACTTGGATACGTTGACGGCATATGGCGTCGTGGTTGACTTTCACCCCATGTTTCTGGGGGCGATTATGAAT
GCCAGCGGCAACAAACCCCCCTGGACCCTCCCAGCAAAGGCCCTCTACCTCGCCCACGACCGCGAGCGCTCCACC
GCCGCCGTGGGCATCACCTGCGGCTCCCCCTCCAACCTCTTTGAACTCGCCAAAACCCAATCCCCCCTCCGCGCC
CTCCTCGCCATAAAGGCCACCTACCCGCCCTCAATCTATACCGCCACTATACTCCATCTCTTTCGCTTCTTTTGG
ACGCCGCCGCACCGCCCCCTCGCAAACGACGCGGTGCTGCAAGATGCGCTCGCGGGCGTCCAAGTCAACGGCAAG
CGCGTATTCGACGCGGCGCAGGTGGCGCACATTATGCAGGCGAGGGAAGAGTATAAGCAGACACTGGTGGACGAG
GTGCAGAGTGCAAGGGAAAAGGGTGCGTTTGGGGCGCCCTGGCTGTGGGTCACTAATGCCAAGGGCGAGAGCCAG
CCGTTTTTTGGCAGTGATCGCTTTAACCAAGTCTTTCGCTTCTTGGGCCTCGACTTTCACGACGTCGAGTTGCTG
CCTCCAAGCGCAAAGCTCTAG
Transcript >OphauB2|4098
ATGGCGGGCGGACGAATCGACTGCTACTTTGACATTGTGTCGCCGTATGCGTACGTTGCAGTGGTGCGGCTGCTG
CGCGACTTGGATACGTTGACGGCATATGGCGTCGTGGTTGACTTTCACCCCATGTTTCTGGGGGCGATTATGAAT
GCCAGCGGCAACAAACCCCCCTGGACCCTCCCAGCAAAGGCCCTCTACCTCGCCCACGACCGCGAGCGCTCCACC
GCCGCCGTGGGCATCACCTGCGGCTCCCCCTCCAACCTCTTTGAACTCGCCAAAACCCAATCCCCCCTCCGCGCC
CTCCTCGCCATAAAGGCCACCTACCCGCCCTCAATCTATACCGCCACTATACTCCATCTCTTTCGCTTCTTTTGG
ACGCCGCCGCACCGCCCCCTCGCAAACGACGCGGTGCTGCAAGATGCGCTCGCGGGCGTCCAAGTCAACGGCAAG
CGCGTATTCGACGCGGCGCAGGTGGCGCACATTATGCAGGCGAGGGAAGAGTATAAGCAGACACTGGTGGACGAG
GTGCAGAGTGCAAGGGAAAAGGGTGCGTTTGGGGCGCCCTGGCTGTGGGTCACTAATGCCAAGGGCGAGAGCCAG
CCGTTTTTTGGCAGTGATCGCTTTAACCAAGTCTTTCGCTTCTTGGGCCTCGACTTTCACGACGTCGAGTTGCTG
CCTCCAAGCGCAAAGCTCTAG
Gene >OphauB2|4098
ATGGCGGGCGGACGAATCGACTGCTACTTTGACATTGGTGATTGATGCTGACTTCGAGAGGGGGATTTGGCTGAC
TTGAGTGTAGTGTCGCCGTATGCGTACGTTGCAGTGGTGCGGCTGCTGCGCGACTTGGATACGTTGACGGCATAT
GGCGTCGTGGTTGAGTTTGTTGCTCGGTGGTGAGGGGTGTTGGTTATTGAGGGCTAATGCGTGGTAGCTTTCACC
CCATGTTTCTGGGGGCGATTATGAATGCCAGCGGCAAGTCGTTCAACTCTTGGCCCTCCTTTTATTCTCTAGCCC
GTTGCTGCTCTTTTACTCTCTCCCTCTCTCTCTCCAGAGCCCCCTTTTTGCTTTGCCACTCCCTCTCTCCAGAGC
CCGCTGCTACCCTCCTTGGACACCCTCTCCTCTGCTACTTGCTCCACTAACTCTCTTCCCACAGGCAACAAACCC
CCCTGGACCCTCCCAGCAAAGGCCCTCTACCTCGCCCACGACCGCGAGCGCTCCACCGCCGCCGTGGGCATCACC
TGCGGCTCCCCCTCCAACCTCTTTGAACTCGCCAAAACCCAATCCCCCCTCCGCGCCCTCCTCGCCATAAAGGCC
ACCTACCCGCCCTCAATCTATACCGCCACTATACTCCATCTCTTTCGCTTCTTTTGGACGCCGCCGCACCGCCCC
CTCGCAAACGACGCGGTGCTGCAAGATGCGCTCGCGGGCGTCCAAGTCAACGGCAAGCGCGTATTCGACGCGGCG
CAGGTGGCGCACATTATGCAGGCGAGGGAAGAGTATAAGCAGACACTGGTGGACGAGGTGCAGAGTGCAAGGGAA
AAGGGTGCGTTTGGGGCGCCCTGGCTGTGGGTCACTAATGCCAAGGGCGAGAGCCAGCCGTTTTTTGGCAGTGAT
CGGTAAGGAGTTTTTTTTTTGCTCCTCCCTTGTCTCCTGGGGTGGCGGTGGGTGCTGACGGCTCGAGCAGCTTTA
ACCAAGTCTTTCGCTTCTTGGGCCTCGACTTTCACGACGTCGAGTTGCTGCCTCCAAGCGCAAAGCTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail