Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4097
Gene name
LocationContig_27:29841..30486
Strand-
Gene length (bp)645
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00186 DHFR_1 Dihydrofolate reductase 1.8E-27 6 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P16184|DYR_PNECA Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 6 207 4.0E-49
sp|Q9U8B8|DYR_HELVI Dihydrofolate reductase OS=Heliothis virescens GN=DHFR PE=1 SV=1 1 206 3.0E-35
sp|Q07801|DYR_CRYNJ Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 6 204 1.0E-32
sp|P22906|DYR_CANAX Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 1 207 3.0E-29
sp|Q920D2|DYR_RAT Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 9 207 5.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P16184|DYR_PNECA Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 6 207 4.0E-49
sp|Q9U8B8|DYR_HELVI Dihydrofolate reductase OS=Heliothis virescens GN=DHFR PE=1 SV=1 1 206 3.0E-35
sp|Q07801|DYR_CRYNJ Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 6 204 1.0E-32
sp|P22906|DYR_CANAX Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 1 207 3.0E-29
sp|Q920D2|DYR_RAT Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 9 207 5.0E-29
sp|P00375|DYR_MOUSE Dihydrofolate reductase OS=Mus musculus GN=Dhfr PE=1 SV=3 9 207 9.0E-29
sp|P00377|DYR_PIG Dihydrofolate reductase OS=Sus scrofa GN=DHFR PE=1 SV=1 9 208 1.0E-28
sp|P00374|DYR_HUMAN Dihydrofolate reductase OS=Homo sapiens GN=DHFR PE=1 SV=2 9 206 3.0E-28
sp|P04753|DYR_MESAU Dihydrofolate reductase OS=Mesocricetus auratus GN=DHFR PE=2 SV=4 9 207 3.0E-28
sp|P00376|DYR_BOVIN Dihydrofolate reductase OS=Bos taurus GN=DHFR PE=1 SV=3 9 208 3.0E-28
sp|P09503|DYR_SHV21 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 11) GN=DHFR PE=3 SV=1 9 208 2.0E-27
sp|P36591|DYR_SCHPO Dihydrofolate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dfr1 PE=2 SV=2 2 206 4.0E-27
sp|P17719|DYR_DROME Dihydrofolate reductase OS=Drosophila melanogaster GN=Dhfr PE=1 SV=3 8 206 4.0E-27
sp|P00378|DYR_CHICK Dihydrofolate reductase OS=Gallus gallus GN=DHFR PE=1 SV=1 9 206 6.0E-27
sp|P28019|DYR_AEDAL Dihydrofolate reductase OS=Aedes albopictus GN=DHFR PE=3 SV=1 8 206 9.0E-27
sp|P22573|DYR_SHV2C Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 488) GN=DHFR PE=3 SV=1 9 206 4.0E-25
sp|P27421|DYR_SHV24 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 484-77) GN=DHFR PE=3 SV=1 9 208 1.0E-24
sp|Q05762|DRTS1_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=1 SV=2 2 158 3.0E-23
sp|Q86XF0|DYRL1_HUMAN Dihydrofolate reductase, mitochondrial OS=Homo sapiens GN=DHFRL1 PE=1 SV=1 9 207 3.0E-23
sp|Q07422|DRTS_TOXGO Bifunctional dihydrofolate reductase-thymidylate synthase OS=Toxoplasma gondii PE=1 SV=1 6 158 6.0E-23
sp|P45350|DRTS_DAUCA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 2 159 8.0E-23
sp|P51820|DRTS_SOYBN Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 8 158 3.0E-22
sp|Q05763|DRTS2_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 2 158 5.0E-22
sp|Q93341|DYR_CAEEL Putative dihydrofolate reductase OS=Caenorhabditis elegans GN=dhfr-1 PE=3 SV=1 8 205 3.0E-21
sp|Q2HRC6|DYR_HHV8P Putative Dihydrofolate reductase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF2 PE=3 SV=1 9 204 3.0E-21
sp|Q27783|DRTS_TRYBB Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma brucei brucei PE=1 SV=1 8 202 1.0E-20
sp|O81395|DRTS_MAIZE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Zea mays GN=DRTS PE=2 SV=1 2 158 1.0E-20
sp|P07807|DYR_YEAST Dihydrofolate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFR1 PE=1 SV=2 6 133 2.0E-18
sp|Q2QRX6|DRTS_ORYSJ Putative bifunctional dihydrofolate reductase-thymidylate synthase OS=Oryza sativa subsp. japonica GN=Os12g0446900 PE=3 SV=2 16 158 5.0E-18
sp|P07382|DRTS_LEIMA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania major GN=LmjF06.0860 PE=1 SV=1 8 180 8.0E-17
sp|P16126|DRTS_LEIAM Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania amazonensis PE=3 SV=1 8 180 8.0E-16
sp|O62583|DYR_ENCCU Dihydrofolate reductase OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHFR-1 PE=3 SV=1 6 158 8.0E-16
sp|Q27793|DRTS_TRYCR Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma cruzi PE=1 SV=2 8 175 1.0E-15
sp|Q5UQG3|DRTS_MIMIV Bifunctional dihydrofolate reductase-thymidylate synthase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R497 PE=3 SV=1 8 165 1.0E-15
sp|P13922|DRTS_PLAFK Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium falciparum (isolate K1 / Thailand) PE=1 SV=2 17 158 4.0E-14
sp|P20712|DRTS_PLACH Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium chabaudi PE=3 SV=1 17 158 3.0E-13
sp|P04174|DYR_NEIGO Dihydrofolate reductase OS=Neisseria gonorrhoeae GN=folA PE=1 SV=1 5 174 4.0E-13
sp|Q54277|DYR_STAHA Dihydrofolate reductase OS=Staphylococcus haemolyticus GN=dfrD PE=1 SV=1 5 206 6.0E-13
sp|Q27713|DRTS_PLABA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium berghei (strain Anka) PE=3 SV=1 17 158 7.0E-13
sp|P43791|DYR_HAEIN Dihydrofolate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folA PE=3 SV=1 8 158 3.0E-12
sp|Q89AV2|DYR_BUCBP Dihydrofolate reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folA PE=3 SV=1 5 158 6.0E-12
sp|Q27828|DRTS_PARTE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Paramecium tetraurelia GN=GSPATT00019973001 PE=3 SV=1 8 157 8.0E-12
sp|O02604|DRTS_PLAVI Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium vivax PE=1 SV=2 17 187 3.0E-11
sp|P9WNX1|DYR_MYCTU Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folA PE=1 SV=2 6 206 5.0E-10
sp|P9WNX0|DYR_MYCTO Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folA PE=3 SV=2 6 206 5.0E-10
sp|P0A547|DYR_MYCBO Dihydrofolate reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folA PE=3 SV=2 6 206 5.0E-10
sp|P12833|DYR3_SALTM Dihydrofolate reductase type 3 OS=Salmonella typhimurium GN=dhfrIII PE=1 SV=1 6 167 5.0E-10
sp|Q9UWQ4|DYRB_HALVO Dihydrofolate reductase HdrB OS=Haloferax volcanii GN=hdrB PE=1 SV=1 7 158 1.0E-09
sp|P0ABQ8|DYR8_SHISO Dihydrofolate reductase type 8 OS=Shigella sonnei GN=dhfrVIII PE=3 SV=1 5 160 2.0E-09
sp|P0ABQ7|DYR8_ECOLX Dihydrofolate reductase type 8 OS=Escherichia coli GN=dhfrVIII PE=3 SV=1 5 160 2.0E-09
sp|P46103|DRTS_PLAVN Bifunctional dihydrofolate reductase-thymidylate synthase (Fragment) OS=Plasmodium vinckei PE=3 SV=1 17 132 3.0E-09
sp|P57243|DYR_BUCAI Dihydrofolate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=folA PE=3 SV=1 5 158 4.0E-09
sp|Q9JSQ9|DYR_NEIMA Dihydrofolate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=folA PE=3 SV=1 5 158 4.0E-09
sp|Q9K168|DYR_NEIMB Dihydrofolate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=folA PE=3 SV=1 5 158 6.0E-09
sp|P31074|DYR_ENTAE Dihydrofolate reductase OS=Enterobacter aerogenes GN=folA PE=3 SV=1 6 158 7.0E-09
sp|P0C0P1|DYR_STAES Dihydrofolate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=folA PE=3 SV=1 8 190 7.0E-09
sp|Q5HPB1|DYR_STAEQ Dihydrofolate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=folA PE=3 SV=1 8 190 7.0E-09
sp|P0C0P0|DYR_STAEP Dihydrofolate reductase OS=Staphylococcus epidermidis GN=folA PE=1 SV=1 8 190 7.0E-09
sp|P31073|DYR_CITFR Dihydrofolate reductase OS=Citrobacter freundii GN=folA PE=3 SV=1 6 158 8.0E-09
sp|P0ABQ6|DYR_SHIFL Dihydrofolate reductase OS=Shigella flexneri GN=folA PE=3 SV=1 6 158 8.0E-09
sp|P0ABQ4|DYR_ECOLI Dihydrofolate reductase OS=Escherichia coli (strain K12) GN=folA PE=1 SV=1 6 158 8.0E-09
sp|P0ABQ5|DYR_ECOL6 Dihydrofolate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folA PE=3 SV=1 6 158 8.0E-09
sp|Q59408|DYR13_ECOLX Dihydrofolate reductase type A13 OS=Escherichia coli GN=dfrA13 PE=3 SV=1 2 169 9.0E-09
sp|Q5V600|DYR2_HALMA Dihydrofolate reductase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folA2 PE=3 SV=1 8 158 2.0E-08
sp|P13955|DYRA_STAAU Dihydrofolate reductase type 1 from Tn4003 OS=Staphylococcus aureus GN=dfrA PE=1 SV=3 8 190 2.0E-08
sp|Q59397|DYR9_ECOLX Dihydrofolate reductase type 9 OS=Escherichia coli GN=dhfrIX PE=3 SV=1 8 161 2.0E-08
sp|Q9CBW1|DYR_MYCLE Dihydrofolate reductase OS=Mycobacterium leprae (strain TN) GN=folA PE=3 SV=1 6 159 2.0E-08
sp|P95524|DYR6_PROMI Dihydrofolate reductase type 6 OS=Proteus mirabilis GN=dhfrVI PE=3 SV=1 5 206 4.0E-08
sp|P15093|DYRA_HALVD Dihydrofolate reductase HdrA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=hdrA PE=1 SV=1 5 171 4.0E-07
sp|Q5V3R2|DYR1_HALMA Dihydrofolate reductase 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folA1 PE=3 SV=1 1 181 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004146 dihydrofolate reductase activity Yes
GO:0046654 tetrahydrofolate biosynthetic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046653 tetrahydrofolate metabolic process No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0042558 pteridine-containing compound metabolic process No
GO:0006760 folic acid-containing compound metabolic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0009987 cellular process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:0009058 biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0009396 folic acid-containing compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4097
MPSSEVVLIVAATRSMGIGVNGSMPWTGLRKEMQYFARVTSRPPPASSPPINAVIMGRKTWDSIPPSYRPLRNRA
NIVVTRDAPANNVPLPDAASPDQPLRLASYAQAIAYATRCYARVYVIGGAQIYAAALAHASPAPSRILLTSIQRD
FDCDVFFPLALGTAEADAMGWRRASPEALEEWTGETVAEGGQHEAGIDYEFQMWEREHCKTSLV*
Coding >OphauB2|4097
ATGCCATCCTCCGAAGTCGTCCTCATCGTCGCCGCCACCCGCTCCATGGGCATCGGTGTCAACGGCTCCATGCCC
TGGACCGGCCTCCGCAAGGAAATGCAATACTTTGCCCGCGTCACCTCGCGCCCCCCGCCAGCCTCGTCTCCGCCC
ATCAACGCCGTCATCATGGGCCGCAAGACGTGGGACTCGATTCCCCCGTCGTACCGCCCGCTCCGCAACCGCGCA
AACATTGTCGTTACGCGCGACGCCCCCGCCAACAATGTCCCTCTGCCTGATGCTGCGTCTCCCGACCAGCCGCTG
CGCCTCGCGTCGTATGCCCAGGCCATTGCCTATGCTACGCGCTGCTACGCACGCGTCTACGTCATTGGCGGCGCG
CAGATTTATGCCGCGGCGCTTGCCCACGCGTCGCCGGCGCCCTCGCGCATCCTGCTCACCTCGATACAGCGCGAC
TTTGACTGCGACGTGTTTTTCCCCCTTGCCTTGGGCACTGCAGAGGCTGATGCCATGGGCTGGAGGCGTGCGTCG
CCTGAGGCGCTCGAGGAGTGGACGGGCGAGACGGTGGCCGAGGGGGGGCAGCATGAGGCGGGCATCGACTACGAG
TTCCAAATGTGGGAGAGAGAGCATTGCAAGACTAGTCTTGTTTGA
Transcript >OphauB2|4097
ATGCCATCCTCCGAAGTCGTCCTCATCGTCGCCGCCACCCGCTCCATGGGCATCGGTGTCAACGGCTCCATGCCC
TGGACCGGCCTCCGCAAGGAAATGCAATACTTTGCCCGCGTCACCTCGCGCCCCCCGCCAGCCTCGTCTCCGCCC
ATCAACGCCGTCATCATGGGCCGCAAGACGTGGGACTCGATTCCCCCGTCGTACCGCCCGCTCCGCAACCGCGCA
AACATTGTCGTTACGCGCGACGCCCCCGCCAACAATGTCCCTCTGCCTGATGCTGCGTCTCCCGACCAGCCGCTG
CGCCTCGCGTCGTATGCCCAGGCCATTGCCTATGCTACGCGCTGCTACGCACGCGTCTACGTCATTGGCGGCGCG
CAGATTTATGCCGCGGCGCTTGCCCACGCGTCGCCGGCGCCCTCGCGCATCCTGCTCACCTCGATACAGCGCGAC
TTTGACTGCGACGTGTTTTTCCCCCTTGCCTTGGGCACTGCAGAGGCTGATGCCATGGGCTGGAGGCGTGCGTCG
CCTGAGGCGCTCGAGGAGTGGACGGGCGAGACGGTGGCCGAGGGGGGGCAGCATGAGGCGGGCATCGACTACGAG
TTCCAAATGTGGGAGAGAGAGCATTGCAAGACTAGTCTTGTTTGA
Gene >OphauB2|4097
ATGCCATCCTCCGAAGTCGTCCTCATCGTCGCCGCCACCCGCTCCATGGGCATCGGTGTCAACGGCTCCATGCCC
TGGACCGGCCTCCGCAAGGAAATGCAATACTTTGCCCGCGTCACCTCGCGCCCCCCGCCAGCCTCGTCTCCGCCC
ATCAACGCCGTCATCATGGGCCGCAAGACGTGGGACTCGATTCCCCCGTCGTACCGCCCGCTCCGCAACCGCGCA
AACATTGTCGTTACGCGCGACGCCCCCGCCAACAATGTCCCTCTGCCTGATGCTGCGTCTCCCGACCAGCCGCTG
CGCCTCGCGTCGTATGCCCAGGCCATTGCCTATGCTACGCGCTGCTACGCACGCGTCTACGTCATTGGCGGCGCG
CAGATTTATGCCGCGGCGCTTGCCCACGCGTCGCCGGCGCCCTCGCGCATCCTGCTCACCTCGATACAGCGCGAC
TTTGACTGCGACGTGTTTTTCCCCCTTGCCTTGGGCACTGCAGAGGCTGATGCCATGGGCTGGAGGCGTGCGTCG
CCTGAGGCGCTCGAGGAGTGGACGGGCGAGACGGTGGCCGAGGGGGGGCAGCATGAGGCGGGCATCGACTACGAG
TTCCAAATGTGGGAGAGAGAGCATTGCAAGACTAGTCTTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail