Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4096
Gene name
LocationContig_27:28507..29704
Strand+
Gene length (bp)1197
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03981 Ubiq_cyt_C_chap Ubiquinol-cytochrome C chaperone 3.1E-32 112 250

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USK6|CBP3_SCHPO CBP3-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbp3 PE=3 SV=1 109 250 3.0E-25
sp|P21560|CBP3_YEAST Protein CBP3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBP3 PE=1 SV=1 95 250 3.0E-22
sp|Q9W6I0|UQCC1_XENLA Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Xenopus laevis GN=uqcc1 PE=2 SV=1 115 233 3.0E-07
sp|Q9CWU6|UQCC1_MOUSE Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Mus musculus GN=Uqcc1 PE=1 SV=1 114 243 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4096
MKTICQGCKTQVCALAPRLARRSAALPLCTGRVGPARQFGSSGPRGLLSFGVKSVADSYRVLGASEALFKACAAP
ADYQVPAWKREEDCVEKREDGEELGEAKTHGNVWHRALRLPVSFNTWSHVTMLHLYLINARLRCFGRETYRTWQQ
QLTDHFFFEAEKKMHLDHAITSSALRQRYLKDLFVQWRGLLLAYDEGLIAGDAILASALWRNLCKGDATTDPCAL
LALVGWIRSGLVEMEAISDAAFPHGVKRILERSIQPFWMKLDGTFQRGPEGDLERGPDGELVLRDDVAGSDVFKR
ATLNTGAEEREKRAAALVAAIKAGRKVK*
Coding >OphauB2|4096
ATGAAAACCATATGCCAAGGCTGCAAAACGCAAGTCTGCGCCCTCGCACCTAGACTAGCCCGCCGCTCTGCCGCC
CTGCCGCTCTGCACAGGGAGGGTGGGCCCGGCGCGGCAGTTTGGTAGTTCGGGGCCGCGGGGGCTGCTGAGTTTC
GGGGTCAAGTCGGTGGCTGATTCGTATCGCGTGCTGGGCGCGTCGGAGGCGCTCTTCAAGGCGTGTGCGGCGCCG
GCGGATTATCAGGTTCCGGCATGGAAGAGGGAGGAGGACTGTGTGGAGAAGAGGGAGGATGGGGAGGAGTTGGGC
GAGGCCAAGACGCATGGCAACGTGTGGCATAGAGCTCTCCGCCTCCCCGTCAGCTTCAACACTTGGTCGCACGTC
ACCATGCTGCACCTCTACCTCATCAATGCGCGCCTCCGCTGCTTTGGGCGCGAAACGTACCGCACCTGGCAGCAA
CAGCTCACTGACCACTTCTTCTTCGAGGCGGAAAAAAAGATGCACCTCGACCACGCCATTACGTCGAGCGCCCTG
CGCCAGCGCTACCTCAAGGACTTGTTTGTCCAGTGGCGCGGCCTGCTGCTCGCCTACGACGAGGGCCTCATTGCC
GGCGACGCCATTCTTGCCAGTGCTTTGTGGCGCAATCTGTGCAAGGGCGATGCTACGACGGATCCATGCGCCTTG
CTTGCATTGGTGGGCTGGATACGGTCTGGCTTGGTGGAGATGGAGGCCATTTCAGATGCTGCCTTTCCACACGGC
GTGAAGCGCATTCTCGAAAGGTCAATACAGCCCTTTTGGATGAAGCTTGACGGTACCTTTCAGCGCGGGCCTGAA
GGTGACCTTGAACGCGGGCCTGATGGTGAGTTGGTCCTGCGCGACGACGTGGCTGGCAGCGACGTGTTCAAAAGG
GCCACGTTGAATACGGGAGCCGAGGAAAGGGAAAAAAGGGCAGCAGCCTTGGTGGCGGCAATCAAGGCGGGCAGA
AAGGTGAAGTAG
Transcript >OphauB2|4096
ATGAAAACCATATGCCAAGGCTGCAAAACGCAAGTCTGCGCCCTCGCACCTAGACTAGCCCGCCGCTCTGCCGCC
CTGCCGCTCTGCACAGGGAGGGTGGGCCCGGCGCGGCAGTTTGGTAGTTCGGGGCCGCGGGGGCTGCTGAGTTTC
GGGGTCAAGTCGGTGGCTGATTCGTATCGCGTGCTGGGCGCGTCGGAGGCGCTCTTCAAGGCGTGTGCGGCGCCG
GCGGATTATCAGGTTCCGGCATGGAAGAGGGAGGAGGACTGTGTGGAGAAGAGGGAGGATGGGGAGGAGTTGGGC
GAGGCCAAGACGCATGGCAACGTGTGGCATAGAGCTCTCCGCCTCCCCGTCAGCTTCAACACTTGGTCGCACGTC
ACCATGCTGCACCTCTACCTCATCAATGCGCGCCTCCGCTGCTTTGGGCGCGAAACGTACCGCACCTGGCAGCAA
CAGCTCACTGACCACTTCTTCTTCGAGGCGGAAAAAAAGATGCACCTCGACCACGCCATTACGTCGAGCGCCCTG
CGCCAGCGCTACCTCAAGGACTTGTTTGTCCAGTGGCGCGGCCTGCTGCTCGCCTACGACGAGGGCCTCATTGCC
GGCGACGCCATTCTTGCCAGTGCTTTGTGGCGCAATCTGTGCAAGGGCGATGCTACGACGGATCCATGCGCCTTG
CTTGCATTGGTGGGCTGGATACGGTCTGGCTTGGTGGAGATGGAGGCCATTTCAGATGCTGCCTTTCCACACGGC
GTGAAGCGCATTCTCGAAAGGTCAATACAGCCCTTTTGGATGAAGCTTGACGGTACCTTTCAGCGCGGGCCTGAA
GGTGACCTTGAACGCGGGCCTGATGGTGAGTTGGTCCTGCGCGACGACGTGGCTGGCAGCGACGTGTTCAAAAGG
GCCACGTTGAATACGGGAGCCGAGGAAAGGGAAAAAAGGGCAGCAGCCTTGGTGGCGGCAATCAAGGCGGGCAGA
AAGGTGAAGTAG
Gene >OphauB2|4096
ATGAAAACCATATGCCAAGGCTGCAAAACGCAAGTCTGCGCCCTCGCACCTAGACTAGCCCGCCGCTCTGCCGCC
CTGCCGCTCTGCACAGGGAGGGTGGGCCCGGCGCGGCAGTTTGGTAGTTCGGGGCCGCGGGGGCTGCTGAGTTTC
GGGGTCAAGTCGGTGGCTGATTCGTATCGCGTGCTGGGCGCGTCGGAGGCGCTCTTCAAGGCGTGTGCGGCGCCG
GCGGATTATCAGGTTCCGGCATGGAAGAGGGAGGAGGACTGTGTGGAGAAGAGGGAGGATGGGGAGGAGTTGGGC
GAGGCCAAGACGCATGGCAACGTGTGGCATAGAGGTTGTCTTTTTTTTTTTTTTCCTTTTTTTCCTTTTTTTTTA
AATCCCTTCATCTACAAGGCAGAGTCGAGTCGAGATTCTTCTACAAGACAGAGTCGAGTCGAGATTCTTCTTCGG
CTTCTACAAGACAGAGTCGAGCCGACAAAATGGCAGCCTGCAGAAAAAAAAAAAAAAGAGAGAAAAAACAACTTT
GCTAACGCTCCTGACCCAGCTCTCCGCCTCCCCGTCAGCTTCAACACTTGGTCGCACGTCACCATGCTGCACCTC
TACCTCATCAATGCGCGCCTCCGCTGCTTTGGGCGCGAAACGTACCGCACCTGGCAGCAACAGCTCACTGACCAC
TTCTTCTTCGAGGCGGAAAAAAAGATGCACCTCGACCACGCCATTACGTCGAGCGCCCTGCGCCAGCGCTACCTC
AAGGACTTGTTTGTCCAGTGGCGCGGCCTGCTGCTCGCCTACGACGAGGGCCTCATTGCCGGCGACGCCATTCTT
GCCAGTGCTTTGTGGCGCAATCTGTGCAAGGGCGATGCTACGACGGATCCATGCGCCTTGCTTGCATTGGTGGGC
TGGATACGGTCTGGCTTGGTGGAGATGGAGGCCATTTCAGATGCTGCCTTTCCACACGGCGTGAAGCGCATTCTC
GAAAGGTCAATACAGCCCTTTTGGATGAAGCTTGACGGTACCTTTCAGCGCGGGCCTGAAGGTGACCTTGAACGC
GGGCCTGATGGTGAGTTGGTCCTGCGCGACGACGTGGCTGGCAGCGACGTGTTCAAAAGGGCCACGTTGAATACG
GGAGCCGAGGAAAGGGAAAAAAGGGCAGCAGCCTTGGTGGCGGCAATCAAGGCGGGCAGAAAGGTGAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail