Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4093
Gene name
LocationContig_27:20548..21971
Strand+
Gene length (bp)1423
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00364 Biotin_lipoyl Biotin-requiring enzyme 4.5E-20 35 108
PF02817 E3_binding e3 binding domain 1.8E-07 167 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94709|ODPX_SCHPO Probable pyruvate dehydrogenase protein X component, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1259.09c PE=2 SV=1 5 270 4.0E-45
sp|P16451|ODPX_YEAST Pyruvate dehydrogenase complex protein X component, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDX1 PE=1 SV=1 4 233 1.0E-43
sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 36 275 7.0E-28
sp|Q8RWN9|ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=2 SV=2 20 331 5.0E-26
sp|O66119|ODP2_ZYMMO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhC PE=3 SV=2 38 298 7.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94709|ODPX_SCHPO Probable pyruvate dehydrogenase protein X component, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1259.09c PE=2 SV=1 5 270 4.0E-45
sp|P16451|ODPX_YEAST Pyruvate dehydrogenase complex protein X component, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDX1 PE=1 SV=1 4 233 1.0E-43
sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 36 275 7.0E-28
sp|Q8RWN9|ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=2 SV=2 20 331 5.0E-26
sp|O66119|ODP2_ZYMMO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhC PE=3 SV=2 38 298 7.0E-25
sp|Q5M729|ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=2 SV=1 22 232 3.0E-24
sp|Q8BKZ9|ODPX_MOUSE Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus GN=Pdhx PE=1 SV=1 18 216 2.0E-23
sp|Q4ULG1|ODP2_RICFE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pdhC PE=3 SV=1 36 205 9.0E-23
sp|Q92HK7|ODP2_RICCN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pdhC PE=3 SV=1 36 205 2.0E-22
sp|P12695|ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAT1 PE=1 SV=1 4 206 3.0E-22
sp|P22439|ODPX_BOVIN Pyruvate dehydrogenase protein X component OS=Bos taurus GN=PDHX PE=1 SV=3 15 203 3.0E-22
sp|O00330|ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens GN=PDHX PE=1 SV=3 18 203 3.0E-21
sp|Q9R9N3|ODP2_RHIME Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rhizobium meliloti (strain 1021) GN=pdhC PE=3 SV=1 35 115 3.0E-21
sp|P20285|ODP2_NEUCR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-3 PE=1 SV=2 38 202 5.0E-21
sp|Q9ZD20|ODP2_RICPR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=pdhC PE=3 SV=1 36 205 7.0E-21
sp|O59816|ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lat1 PE=3 SV=1 28 202 2.0E-20
sp|Q0WQF7|ODP21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=2 SV=2 38 206 3.0E-20
sp|Q68WK6|ODP2_RICTY Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=pdhC PE=3 SV=1 36 205 3.0E-19
sp|Q0WQF7|ODP21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=2 SV=2 38 152 1.0E-18
sp|P36413|ODP2_DICDI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=1 SV=2 33 136 2.0E-18
sp|Q92J43|ODO2_RICCN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucB PE=3 SV=1 36 386 5.0E-18
sp|Q9R9N4|ODPB_RHIME Pyruvate dehydrogenase E1 component subunit beta OS=Rhizobium meliloti (strain 1021) GN=pdhB PE=3 SV=2 35 128 9.0E-18
sp|Q1RHI5|ODO2_RICBR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=sucB PE=3 SV=1 36 386 2.0E-17
sp|O66113|ODPB_ZYMMO Pyruvate dehydrogenase E1 component subunit beta OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhB PE=3 SV=2 38 133 3.0E-17
sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 35 206 1.0E-16
sp|Q19749|ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1 27 145 4.0E-16
sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 35 206 6.0E-16
sp|Q4UKI7|ODO2_RICFE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucB PE=3 SV=1 36 386 9.0E-16
sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 37 206 8.0E-15
sp|Q9ZDY4|ODO2_RICPR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=sucB PE=3 SV=1 36 386 1.0E-14
sp|Q68XI8|ODO2_RICTY Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucB PE=3 SV=1 36 355 4.0E-14
sp|Q9C8P0|ODP25_ARATH Dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana GN=EMB3003 PE=2 SV=1 18 116 2.0E-13
sp|P36413|ODP2_DICDI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=1 SV=2 27 206 4.0E-13
sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 34 120 5.0E-12
sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 34 120 7.0E-12
sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 34 120 4.0E-11
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 10 211 4.0E-10
sp|P16263|ODO2_BACSU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=odhB PE=3 SV=2 38 205 7.0E-10
sp|Q9SQI8|ODP24_ARATH Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic OS=Arabidopsis thaliana GN=LTA2 PE=2 SV=1 22 108 9.0E-10
sp|Q8CSL9|ODO2_STAES Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=odhB PE=3 SV=1 38 308 3.0E-09
sp|Q6GGZ6|ODO2_STAAR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=odhB PE=3 SV=1 38 186 4.0E-09
sp|Q49XM4|ODO2_STAS1 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=odhB PE=3 SV=1 38 152 5.0E-09
sp|Q5HPC7|ODO2_STAEQ Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=odhB PE=3 SV=1 38 308 7.0E-09
sp|O31550|ACOC_BACSU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Bacillus subtilis (strain 168) GN=acoC PE=3 SV=1 33 296 1.0E-08
sp|P37942|ODB2_BACSU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=bfmBB PE=3 SV=1 31 266 2.0E-08
sp|P0AFG6|ODO2_ECOLI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli (strain K12) GN=sucB PE=1 SV=2 31 206 3.0E-08
sp|P0AFG7|ODO2_ECO57 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli O157:H7 GN=sucB PE=1 SV=2 31 206 3.0E-08
sp|Q2YY06|ODO2_STAAB Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=odhB PE=3 SV=1 38 186 4.0E-08
sp|Q8CT13|ODP2_STAES Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhC PE=3 SV=1 36 220 5.0E-08
sp|Q5HQ74|ODP2_STAEQ Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhC PE=3 SV=1 36 208 7.0E-08
sp|Q7A5N4|ODO2_STAAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=odhB PE=1 SV=1 38 110 8.0E-08
sp|Q99U75|ODO2_STAAM Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=odhB PE=3 SV=1 38 110 8.0E-08
sp|Q8NWR7|ODO2_STAAW Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=odhB PE=3 SV=1 38 110 8.0E-08
sp|Q6G9E9|ODO2_STAAS Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=odhB PE=3 SV=1 38 110 8.0E-08
sp|Q5HG07|ODO2_STAAC Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=odhB PE=3 SV=1 38 110 8.0E-08
sp|Q2FYM2|ODO2_STAA8 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain NCTC 8325) GN=odhB PE=3 SV=1 38 110 8.0E-08
sp|Q2FH26|ODO2_STAA3 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain USA300) GN=odhB PE=3 SV=1 38 110 8.0E-08
sp|Q6GHZ0|ODP2_STAAR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=pdhC PE=3 SV=1 36 253 2.0E-07
sp|P65635|ODP2_STAAM Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhC PE=3 SV=1 36 253 2.0E-07
sp|P65636|ODP2_STAAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=pdhC PE=1 SV=1 36 253 2.0E-07
sp|Q8NX76|ODP2_STAAW Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=pdhC PE=3 SV=1 36 253 3.0E-07
sp|Q6GAB9|ODP2_STAAS Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=pdhC PE=3 SV=1 36 253 3.0E-07
sp|Q5HGY9|ODP2_STAAC Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=pdhC PE=3 SV=1 36 253 3.0E-07
sp|Q59821|ODP2_STAAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus GN=pdhC PE=3 SV=1 36 253 3.0E-07
sp|Q89AJ6|ODO2_BUCBP Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=sucB PE=3 SV=1 35 219 7.0E-07
sp|P45302|ODO2_HAEIN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucB PE=3 SV=1 33 202 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1272
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5792
Ophiocordyceps australis map64 (Brazil) OphauB2|4093 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04487
Ophiocordyceps camponoti-rufipedis Ophun1|970
Ophiocordyceps kimflemingae Ophio5|1594
Ophiocordyceps subramaniannii Hirsu2|10541

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4093
MASLATTCRVSARLLGRRAATRAFTTSSRCLAAQNFVMPALSPTMTEGNIASWSVSEGQSFSAGDVLLEIETDKA
TMDVEAQEDGVVFKILAEKGAKGVQVGARIAVLAEPGDDLASLEEPRAQASKAPDASPEPKTTETSSTPSRQPDK
DDAATKGQTQHALRRPLLPSVEFLVHEHRIAPADVARIKPTGPGGRLLKGDVLAYLGAIAASSPAAVSSRFAKLA
ALDLSNIKVAAPVAPSQPLEPAPPPTTQLNMPVSLASVLEVQKRIHDSLGVLLPLSTFISRATDVANEALPRVPA
PPTPSELFDQVLGLHSVKAAAGSRGVYQPQISALVPQAQLRPAPRARAAQPSLFDEIVGPRTKTAPRRAGPMTMP
GLSSGDNVFSLVVPKNEEKRGRLFLERCKTILEKEPGRLVL*
Coding >OphauB2|4093
ATGGCGTCACTAGCGACGACATGCCGTGTGTCAGCGCGCCTACTCGGTCGTCGGGCCGCAACTCGAGCCTTTACC
ACGTCGTCTAGATGCCTCGCGGCGCAAAATTTTGTCATGCCTGCGCTATCGCCGACAATGACCGAGGGCAACATT
GCCAGCTGGAGCGTCAGCGAGGGCCAGTCCTTTTCGGCAGGCGACGTGCTGCTGGAGATTGAGACGGACAAGGCG
ACGATGGATGTCGAGGCGCAAGAAGACGGCGTCGTCTTCAAGATTTTGGCGGAAAAGGGCGCAAAGGGCGTGCAG
GTGGGTGCGCGCATCGCCGTCTTGGCCGAGCCGGGAGACGACTTGGCATCGCTCGAGGAGCCGCGCGCGCAGGCC
AGCAAAGCTCCCGACGCGAGTCCCGAGCCCAAGACTACCGAGACGAGCAGCACGCCCTCGCGTCAGCCCGACAAG
GACGACGCCGCCACAAAGGGCCAGACGCAGCACGCGCTCCGGCGGCCCCTTTTGCCGTCTGTCGAGTTTCTAGTC
CACGAGCACCGCATCGCCCCCGCCGACGTGGCGCGTATCAAGCCCACAGGCCCCGGCGGCCGCCTGCTAAAGGGC
GACGTGCTGGCATATCTGGGCGCCATTGCCGCCTCGTCGCCCGCCGCCGTGTCGAGCCGCTTCGCCAAGCTGGCC
GCTCTCGACCTGAGCAACATCAAGGTTGCCGCGCCCGTGGCTCCCTCCCAGCCCCTTGAGCCCGCCCCACCGCCC
ACGACGCAGCTCAACATGCCCGTCTCGCTCGCCAGCGTGCTCGAGGTGCAGAAGCGCATCCACGACTCGCTCGGC
GTCTTGCTCCCGCTCTCAACCTTTATCTCGCGCGCCACCGACGTGGCCAATGAAGCCCTGCCGCGCGTCCCGGCG
CCGCCCACGCCCTCGGAGCTCTTTGACCAGGTCCTTGGCCTGCACAGCGTCAAGGCGGCGGCCGGCTCGCGCGGC
GTCTACCAGCCTCAAATCTCAGCCCTGGTGCCGCAGGCGCAGCTTAGGCCGGCGCCGCGGGCACGTGCTGCGCAG
CCTAGTCTGTTTGACGAAATAGTTGGGCCGCGGACCAAGACTGCGCCCAGACGAGCTGGCCCCATGACCATGCCG
GGCTTGTCGAGCGGTGACAATGTGTTTAGTCTTGTGGTGCCCAAGAATGAGGAGAAGCGAGGCCGGCTTTTCCTC
GAGCGCTGCAAGACCATTTTGGAAAAGGAGCCGGGCCGTCTGGTTCTGTAG
Transcript >OphauB2|4093
ATGGCGTCACTAGCGACGACATGCCGTGTGTCAGCGCGCCTACTCGGTCGTCGGGCCGCAACTCGAGCCTTTACC
ACGTCGTCTAGATGCCTCGCGGCGCAAAATTTTGTCATGCCTGCGCTATCGCCGACAATGACCGAGGGCAACATT
GCCAGCTGGAGCGTCAGCGAGGGCCAGTCCTTTTCGGCAGGCGACGTGCTGCTGGAGATTGAGACGGACAAGGCG
ACGATGGATGTCGAGGCGCAAGAAGACGGCGTCGTCTTCAAGATTTTGGCGGAAAAGGGCGCAAAGGGCGTGCAG
GTGGGTGCGCGCATCGCCGTCTTGGCCGAGCCGGGAGACGACTTGGCATCGCTCGAGGAGCCGCGCGCGCAGGCC
AGCAAAGCTCCCGACGCGAGTCCCGAGCCCAAGACTACCGAGACGAGCAGCACGCCCTCGCGTCAGCCCGACAAG
GACGACGCCGCCACAAAGGGCCAGACGCAGCACGCGCTCCGGCGGCCCCTTTTGCCGTCTGTCGAGTTTCTAGTC
CACGAGCACCGCATCGCCCCCGCCGACGTGGCGCGTATCAAGCCCACAGGCCCCGGCGGCCGCCTGCTAAAGGGC
GACGTGCTGGCATATCTGGGCGCCATTGCCGCCTCGTCGCCCGCCGCCGTGTCGAGCCGCTTCGCCAAGCTGGCC
GCTCTCGACCTGAGCAACATCAAGGTTGCCGCGCCCGTGGCTCCCTCCCAGCCCCTTGAGCCCGCCCCACCGCCC
ACGACGCAGCTCAACATGCCCGTCTCGCTCGCCAGCGTGCTCGAGGTGCAGAAGCGCATCCACGACTCGCTCGGC
GTCTTGCTCCCGCTCTCAACCTTTATCTCGCGCGCCACCGACGTGGCCAATGAAGCCCTGCCGCGCGTCCCGGCG
CCGCCCACGCCCTCGGAGCTCTTTGACCAGGTCCTTGGCCTGCACAGCGTCAAGGCGGCGGCCGGCTCGCGCGGC
GTCTACCAGCCTCAAATCTCAGCCCTGGTGCCGCAGGCGCAGCTTAGGCCGGCGCCGCGGGCACGTGCTGCGCAG
CCTAGTCTGTTTGACGAAATAGTTGGGCCGCGGACCAAGACTGCGCCCAGACGAGCTGGCCCCATGACCATGCCG
GGCTTGTCGAGCGGTGACAATGTGTTTAGTCTTGTGGTGCCCAAGAATGAGGAGAAGCGAGGCCGGCTTTTCCTC
GAGCGCTGCAAGACCATTTTGGAAAAGGAGCCGGGCCGTCTGGTTCTGTAG
Gene >OphauB2|4093
ATGGCGTCACTAGCGACGACATGCCGTGTGTCAGCGCGCCTACTCGGTCGTCGGGCCGCAACTCGAGGTACGATT
ATCACAGAGTCCAAGTCGGAGCGAGTAGAAGGGAAAAAAAAAAAAAAAAAAAAGAGGGCTAGTGCCAAGTCTTTG
CGCCAGAGGAAGAATTTCACAAACATGAAGAAGAAGCCAAGCACCACAGCAAAAGAAGACTAACTGGACCGATTT
CACCCCATAAACAGCCTTTACCACGTCGTCTAGATGCCTCGCGGCGCAAAATTTTGTCATGCCTGCGCTATCGCC
GACAATGACCGAGGGCAACATTGCCAGCTGGAGCGTCAGCGAGGGCCAGTCCTTTTCGGCAGGCGACGTGCTGCT
GGAGATTGAGACGGACAAGGCGACGATGGATGTCGAGGCGCAAGAAGACGGCGTCGTCTTCAAGATTTTGGCGGA
AAAGGGCGCAAAGGGCGTGCAGGTGGGTGCGCGCATCGCCGTCTTGGCCGAGCCGGGAGACGACTTGGCATCGCT
CGAGGAGCCGCGCGCGCAGGCCAGCAAAGCTCCCGACGCGAGTCCCGAGCCCAAGACTACCGAGACGAGCAGCAC
GCCCTCGCGTCAGCCCGACAAGGACGACGCCGCCACAAAGGGCCAGACGCAGCACGCGCTCCGGCGGCCCCTTTT
GCCGTCTGTCGAGTTTCTAGTCCACGAGCACCGCATCGCCCCCGCCGACGTGGCGCGTATCAAGCCCACAGGCCC
CGGCGGCCGCCTGCTAAAGGGCGACGTGCTGGCATATCTGGGCGCCATTGCCGCCTCGTCGCCCGCCGCCGTGTC
GAGCCGCTTCGCCAAGCTGGCCGCTCTCGACCTGAGCAACATCAAGGTTGCCGCGCCCGTGGCTCCCTCCCAGCC
CCTTGAGCCCGCCCCACCGCCCACGACGCAGCTCAACATGCCCGTCTCGCTCGCCAGCGTGCTCGAGGTGCAGAA
GCGCATCCACGACTCGCTCGGCGTCTTGCTCCCGCTCTCAACCTTTATCTCGCGCGCCACCGACGTGGCCAATGA
AGCCCTGCCGCGCGTCCCGGCGCCGCCCACGCCCTCGGAGCTCTTTGACCAGGTCCTTGGCCTGCACAGCGTCAA
GGCGGCGGCCGGCTCGCGCGGCGTCTACCAGCCTCAAATCTCAGCCCTGGTGCCGCAGGCGCAGCTTAGGCCGGC
GCCGCGGGCACGTGCTGCGCAGCCTAGTCTGTTTGACGAAATAGTTGGGCCGCGGACCAAGACTGCGCCCAGACG
AGCTGGCCCCATGACCATGCCGGGCTTGTCGAGCGGTGACAATGTGTTTAGTCTTGTGGTGCCCAAGAATGAGGA
GAAGCGAGGCCGGCTTTTCCTCGAGCGCTGCAAGACCATTTTGGAAAAGGAGCCGGGCCGTCTGGTTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail