Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4087
Gene name
LocationContig_269:9557..12797
Strand+
Gene length (bp)3240
Transcript length (bp)3240
Coding sequence length (bp)3240
Protein length (aa) 1080

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 297 459 7.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4087
MNNPSAYTPLESLFLFQSLLTTGVDAGAFASVSEALTNNALVRGGATFDPARLTPEALQQLFLVLVGDEARNEGE
RADGATDGPASPGSRKRKLGGLSPLSSIIEASQHVDKLPGLIERLYVRYRDHLVQEIREDERQFKVVQSQIQGLE
KIERERLAKAASAGQNNAAALAAREAAKPSGTSHVANPLPAPTAASGVKRGPAPNTVAKPVVSTTSQQAAAPVRS
NPSPVPPPNGPGAIAQPPAAATPRVLQAPAPSTKTAAVARPESSNKSRDEANGPTAATLGGVLKWEKPYQPLQPG
QTQSIGQSSPQVATSSGPQKNQQQQQQQLQQQQQQQQQQKQLQQQQQQQQQQQPQQQPQQQQQQQQQQQQQQLQQ
QKQQLQQQKQQLQQQKQQLQQQQQQQQQRQQWQNSQQQQQQTPSQPQASKRPHKLHTPQQTLKQPQKQTAPQQQQ
EQQIQPSVQFLGQTSGPPPRPRSPRVDPVFAPSPQAPQQVTALVQPCSPHPVGGTSSPVTNASLCRPQPVAPVVS
PGLGLAVHSQQHQQPQEQRQQQPSSQSRPQTQPQPQPQQQQATKPSQQQMLRPIALAPPLSEPMPSPSLKQSQNS
ATTQPGQRAPSVAQPSLANQSNRSNEAHVPSYSYQAPKPMVSEFVRQATEAPGVGHASSGINPQTPRPVGPIAFA
RGLGTKWAPKSTPSTPRPTAVEPESPAYEPASPRLARRPPSRPPSTPADTPRNTVRKVMPKPSYHSDIMASRRRS
RGGGETGAIAMTSSSRPARRSPSVASQTDELSLDHSAFSTRVKREAMTPRAHDDAGDTTADESILGRTHMVTPGS
VTSRLAKRKRPESPNGGLTPPTQVLWTRGFTKVSSSALDQISSHRHANMFATGVREKDAPNYRQIVLQPQDITSI
RAAIKQGNKAAMQAASCLPGGGDPGTANVWLPISEDLVPPRGIINSAQLERELVHIFCNAIMYNPDPNRGPGPAF
MKRSTDEEEEVVGYHLDENGVVKNTRSMFVEVEKLLGELRSAEKDRGVPAMRQISVSPADDSAEDEDELAGDGGI
SGATFGKRRRVSMRSSISQQPSSSVKAPQ*
Coding >OphauB2|4087
ATGAATAATCCGTCAGCTTATACGCCGCTCGAGTCGCTGTTTCTCTTTCAGTCGCTCCTGACCACGGGCGTCGAT
GCTGGTGCTTTTGCGAGCGTCTCCGAGGCGCTCACCAACAACGCCCTTGTACGGGGCGGCGCGACATTCGATCCG
GCGCGTCTGACACCCGAGGCGCTGCAGCAGCTGTTTCTCGTGCTGGTTGGAGACGAGGCGAGGAATGAAGGAGAG
CGGGCCGATGGCGCGACGGACGGACCTGCGTCTCCCGGCTCACGCAAGAGGAAGCTCGGGGGCTTGTCACCCTTG
TCCTCAATCATAGAAGCTTCGCAACATGTCGACAAGCTGCCAGGTCTGATAGAAAGACTCTATGTGCGGTACCGG
GACCACCTTGTGCAAGAGATTCGAGAGGACGAACGCCAATTCAAGGTGGTGCAAAGCCAGATCCAGGGCCTGGAA
AAGATTGAGAGGGAGCGCCTTGCCAAGGCTGCTAGTGCTGGCCAGAACAACGCAGCAGCTCTTGCTGCTCGAGAA
GCGGCCAAGCCCTCTGGCACATCTCATGTTGCCAATCCGTTGCCCGCTCCGACTGCCGCCAGCGGTGTCAAGCGC
GGACCGGCTCCGAACACAGTAGCAAAGCCGGTAGTGTCAACGACCTCGCAGCAAGCAGCTGCTCCAGTGCGCTCA
AATCCATCGCCTGTGCCGCCTCCGAATGGTCCTGGTGCTATTGCACAGCCTCCAGCAGCAGCTACACCACGGGTC
CTCCAGGCACCAGCGCCATCTACCAAGACAGCTGCAGTGGCGCGGCCAGAAAGCTCCAACAAGTCAAGAGATGAG
GCTAATGGGCCGACGGCGGCGACCTTGGGAGGCGTGCTGAAATGGGAGAAACCATATCAACCTCTACAGCCGGGC
CAGACTCAATCTATCGGGCAGTCGTCGCCTCAAGTAGCCACCTCTAGTGGGCCACAGAAGAACCAGCAGCAGCAG
CAGCAGCAGTTACAGCAACAACAACAGCAACAGCAGCAGCAGAAGCAGCTACAACAGCAACAGCAACAGCAGCAG
CAACAACAGCCGCAACAACAGCCGCAACAACAGCAGCAACAACAGCAACAACAACAGCAACAGCAGCTACAGCAG
CAAAAACAACAGCTACAGCAGCAAAAACAACAGCTACAGCAGCAAAAACAACAGCTACAGCAACAACAACAACAA
CAACAGCAACGACAACAGTGGCAAAATTCACAGCAGCAACAGCAGCAGACACCATCGCAGCCACAAGCATCCAAA
CGGCCGCACAAGCTACATACCCCGCAACAAACATTGAAACAGCCCCAGAAGCAAACGGCACCACAGCAACAGCAA
GAGCAGCAGATTCAGCCCTCTGTACAGTTCCTTGGGCAAACATCTGGCCCGCCACCGCGACCTCGCTCACCTCGT
GTGGATCCTGTCTTTGCTCCCTCTCCTCAAGCTCCCCAACAGGTGACTGCGCTTGTGCAGCCGTGCTCTCCTCAT
CCTGTAGGAGGCACTTCTTCACCAGTGACAAATGCTTCACTCTGTCGGCCTCAGCCTGTGGCACCTGTCGTGTCC
CCTGGGCTTGGGCTAGCAGTCCACTCGCAACAACATCAGCAGCCTCAAGAACAACGGCAGCAGCAACCTTCATCT
CAATCTCGACCGCAAACTCAGCCCCAACCTCAACCACAGCAACAGCAGGCAACCAAGCCCTCACAACAGCAGATG
CTACGCCCCATAGCTTTAGCTCCTCCATTATCCGAACCTATGCCTTCACCCTCATTAAAACAGTCTCAGAATTCA
GCAACGACACAACCAGGACAACGCGCGCCATCTGTCGCACAGCCTTCGCTCGCAAATCAATCCAATAGGTCGAAT
GAAGCACATGTACCATCATATTCCTATCAGGCCCCCAAACCAATGGTATCCGAATTTGTTCGACAGGCAACAGAA
GCTCCAGGAGTCGGGCATGCTAGTTCTGGGATTAATCCTCAAACTCCTCGACCTGTCGGTCCGATAGCGTTCGCG
CGAGGTCTTGGAACGAAATGGGCCCCCAAGTCAACGCCATCGACTCCAAGGCCTACGGCTGTCGAGCCTGAGAGC
CCTGCTTATGAACCTGCCAGTCCCAGACTTGCACGGCGTCCCCCTTCTCGACCGCCTTCAACTCCTGCTGATACT
CCCAGAAATACTGTGAGAAAGGTTATGCCAAAGCCTTCCTACCACTCAGATATCATGGCCTCACGGCGCCGCAGT
CGAGGTGGGGGGGAGACTGGAGCCATTGCTATGACATCTTCTTCGCGTCCTGCAAGACGTAGCCCTTCTGTTGCA
TCGCAAACAGATGAGCTGTCGTTGGATCATTCTGCCTTTTCTACCAGGGTCAAGCGGGAGGCAATGACACCTCGA
GCGCATGATGATGCAGGAGACACTACAGCCGACGAGAGCATTCTAGGTCGAACGCACATGGTGACGCCTGGTAGC
GTAACGTCGCGACTGGCCAAGAGAAAGAGGCCGGAATCGCCCAACGGTGGACTGACACCCCCAACACAGGTGTTG
TGGACTCGGGGATTTACCAAGGTTTCGTCGTCGGCCCTTGATCAGATTTCAAGCCATCGTCATGCAAACATGTTT
GCAACGGGTGTACGAGAGAAGGATGCGCCAAATTACCGGCAGATTGTGCTTCAACCCCAGGACATCACGTCGATT
CGAGCGGCGATCAAGCAGGGAAATAAGGCGGCTATGCAGGCTGCTAGCTGTCTACCGGGAGGCGGTGACCCAGGG
ACGGCCAATGTGTGGCTACCAATATCTGAGGATCTGGTGCCTCCTCGAGGCATCATCAATAGCGCGCAGTTGGAA
AGAGAATTGGTGCACATCTTTTGCAACGCCATCATGTATAATCCGGATCCGAACCGCGGACCTGGCCCGGCCTTT
ATGAAGCGATCTACAGATGAGGAGGAAGAGGTGGTGGGCTACCATCTCGATGAAAACGGCGTTGTCAAGAATACC
CGCAGTATGTTTGTCGAGGTGGAAAAGCTCTTGGGCGAACTCCGAAGTGCGGAAAAGGATCGTGGGGTGCCAGCT
ATGCGCCAGATTAGTGTTTCGCCAGCTGACGACTCGGCCGAGGATGAAGACGAACTGGCAGGCGATGGAGGCATT
TCTGGAGCTACGTTTGGTAAAAGACGACGTGTGAGTATGCGGTCAAGTATTAGCCAGCAGCCTTCTTCTTCTGTT
AAAGCTCCACAATGA
Transcript >OphauB2|4087
ATGAATAATCCGTCAGCTTATACGCCGCTCGAGTCGCTGTTTCTCTTTCAGTCGCTCCTGACCACGGGCGTCGAT
GCTGGTGCTTTTGCGAGCGTCTCCGAGGCGCTCACCAACAACGCCCTTGTACGGGGCGGCGCGACATTCGATCCG
GCGCGTCTGACACCCGAGGCGCTGCAGCAGCTGTTTCTCGTGCTGGTTGGAGACGAGGCGAGGAATGAAGGAGAG
CGGGCCGATGGCGCGACGGACGGACCTGCGTCTCCCGGCTCACGCAAGAGGAAGCTCGGGGGCTTGTCACCCTTG
TCCTCAATCATAGAAGCTTCGCAACATGTCGACAAGCTGCCAGGTCTGATAGAAAGACTCTATGTGCGGTACCGG
GACCACCTTGTGCAAGAGATTCGAGAGGACGAACGCCAATTCAAGGTGGTGCAAAGCCAGATCCAGGGCCTGGAA
AAGATTGAGAGGGAGCGCCTTGCCAAGGCTGCTAGTGCTGGCCAGAACAACGCAGCAGCTCTTGCTGCTCGAGAA
GCGGCCAAGCCCTCTGGCACATCTCATGTTGCCAATCCGTTGCCCGCTCCGACTGCCGCCAGCGGTGTCAAGCGC
GGACCGGCTCCGAACACAGTAGCAAAGCCGGTAGTGTCAACGACCTCGCAGCAAGCAGCTGCTCCAGTGCGCTCA
AATCCATCGCCTGTGCCGCCTCCGAATGGTCCTGGTGCTATTGCACAGCCTCCAGCAGCAGCTACACCACGGGTC
CTCCAGGCACCAGCGCCATCTACCAAGACAGCTGCAGTGGCGCGGCCAGAAAGCTCCAACAAGTCAAGAGATGAG
GCTAATGGGCCGACGGCGGCGACCTTGGGAGGCGTGCTGAAATGGGAGAAACCATATCAACCTCTACAGCCGGGC
CAGACTCAATCTATCGGGCAGTCGTCGCCTCAAGTAGCCACCTCTAGTGGGCCACAGAAGAACCAGCAGCAGCAG
CAGCAGCAGTTACAGCAACAACAACAGCAACAGCAGCAGCAGAAGCAGCTACAACAGCAACAGCAACAGCAGCAG
CAACAACAGCCGCAACAACAGCCGCAACAACAGCAGCAACAACAGCAACAACAACAGCAACAGCAGCTACAGCAG
CAAAAACAACAGCTACAGCAGCAAAAACAACAGCTACAGCAGCAAAAACAACAGCTACAGCAACAACAACAACAA
CAACAGCAACGACAACAGTGGCAAAATTCACAGCAGCAACAGCAGCAGACACCATCGCAGCCACAAGCATCCAAA
CGGCCGCACAAGCTACATACCCCGCAACAAACATTGAAACAGCCCCAGAAGCAAACGGCACCACAGCAACAGCAA
GAGCAGCAGATTCAGCCCTCTGTACAGTTCCTTGGGCAAACATCTGGCCCGCCACCGCGACCTCGCTCACCTCGT
GTGGATCCTGTCTTTGCTCCCTCTCCTCAAGCTCCCCAACAGGTGACTGCGCTTGTGCAGCCGTGCTCTCCTCAT
CCTGTAGGAGGCACTTCTTCACCAGTGACAAATGCTTCACTCTGTCGGCCTCAGCCTGTGGCACCTGTCGTGTCC
CCTGGGCTTGGGCTAGCAGTCCACTCGCAACAACATCAGCAGCCTCAAGAACAACGGCAGCAGCAACCTTCATCT
CAATCTCGACCGCAAACTCAGCCCCAACCTCAACCACAGCAACAGCAGGCAACCAAGCCCTCACAACAGCAGATG
CTACGCCCCATAGCTTTAGCTCCTCCATTATCCGAACCTATGCCTTCACCCTCATTAAAACAGTCTCAGAATTCA
GCAACGACACAACCAGGACAACGCGCGCCATCTGTCGCACAGCCTTCGCTCGCAAATCAATCCAATAGGTCGAAT
GAAGCACATGTACCATCATATTCCTATCAGGCCCCCAAACCAATGGTATCCGAATTTGTTCGACAGGCAACAGAA
GCTCCAGGAGTCGGGCATGCTAGTTCTGGGATTAATCCTCAAACTCCTCGACCTGTCGGTCCGATAGCGTTCGCG
CGAGGTCTTGGAACGAAATGGGCCCCCAAGTCAACGCCATCGACTCCAAGGCCTACGGCTGTCGAGCCTGAGAGC
CCTGCTTATGAACCTGCCAGTCCCAGACTTGCACGGCGTCCCCCTTCTCGACCGCCTTCAACTCCTGCTGATACT
CCCAGAAATACTGTGAGAAAGGTTATGCCAAAGCCTTCCTACCACTCAGATATCATGGCCTCACGGCGCCGCAGT
CGAGGTGGGGGGGAGACTGGAGCCATTGCTATGACATCTTCTTCGCGTCCTGCAAGACGTAGCCCTTCTGTTGCA
TCGCAAACAGATGAGCTGTCGTTGGATCATTCTGCCTTTTCTACCAGGGTCAAGCGGGAGGCAATGACACCTCGA
GCGCATGATGATGCAGGAGACACTACAGCCGACGAGAGCATTCTAGGTCGAACGCACATGGTGACGCCTGGTAGC
GTAACGTCGCGACTGGCCAAGAGAAAGAGGCCGGAATCGCCCAACGGTGGACTGACACCCCCAACACAGGTGTTG
TGGACTCGGGGATTTACCAAGGTTTCGTCGTCGGCCCTTGATCAGATTTCAAGCCATCGTCATGCAAACATGTTT
GCAACGGGTGTACGAGAGAAGGATGCGCCAAATTACCGGCAGATTGTGCTTCAACCCCAGGACATCACGTCGATT
CGAGCGGCGATCAAGCAGGGAAATAAGGCGGCTATGCAGGCTGCTAGCTGTCTACCGGGAGGCGGTGACCCAGGG
ACGGCCAATGTGTGGCTACCAATATCTGAGGATCTGGTGCCTCCTCGAGGCATCATCAATAGCGCGCAGTTGGAA
AGAGAATTGGTGCACATCTTTTGCAACGCCATCATGTATAATCCGGATCCGAACCGCGGACCTGGCCCGGCCTTT
ATGAAGCGATCTACAGATGAGGAGGAAGAGGTGGTGGGCTACCATCTCGATGAAAACGGCGTTGTCAAGAATACC
CGCAGTATGTTTGTCGAGGTGGAAAAGCTCTTGGGCGAACTCCGAAGTGCGGAAAAGGATCGTGGGGTGCCAGCT
ATGCGCCAGATTAGTGTTTCGCCAGCTGACGACTCGGCCGAGGATGAAGACGAACTGGCAGGCGATGGAGGCATT
TCTGGAGCTACGTTTGGTAAAAGACGACGTGTGAGTATGCGGTCAAGTATTAGCCAGCAGCCTTCTTCTTCTGTT
AAAGCTCCACAATGA
Gene >OphauB2|4087
ATGAATAATCCGTCAGCTTATACGCCGCTCGAGTCGCTGTTTCTCTTTCAGTCGCTCCTGACCACGGGCGTCGAT
GCTGGTGCTTTTGCGAGCGTCTCCGAGGCGCTCACCAACAACGCCCTTGTACGGGGCGGCGCGACATTCGATCCG
GCGCGTCTGACACCCGAGGCGCTGCAGCAGCTGTTTCTCGTGCTGGTTGGAGACGAGGCGAGGAATGAAGGAGAG
CGGGCCGATGGCGCGACGGACGGACCTGCGTCTCCCGGCTCACGCAAGAGGAAGCTCGGGGGCTTGTCACCCTTG
TCCTCAATCATAGAAGCTTCGCAACATGTCGACAAGCTGCCAGGTCTGATAGAAAGACTCTATGTGCGGTACCGG
GACCACCTTGTGCAAGAGATTCGAGAGGACGAACGCCAATTCAAGGTGGTGCAAAGCCAGATCCAGGGCCTGGAA
AAGATTGAGAGGGAGCGCCTTGCCAAGGCTGCTAGTGCTGGCCAGAACAACGCAGCAGCTCTTGCTGCTCGAGAA
GCGGCCAAGCCCTCTGGCACATCTCATGTTGCCAATCCGTTGCCCGCTCCGACTGCCGCCAGCGGTGTCAAGCGC
GGACCGGCTCCGAACACAGTAGCAAAGCCGGTAGTGTCAACGACCTCGCAGCAAGCAGCTGCTCCAGTGCGCTCA
AATCCATCGCCTGTGCCGCCTCCGAATGGTCCTGGTGCTATTGCACAGCCTCCAGCAGCAGCTACACCACGGGTC
CTCCAGGCACCAGCGCCATCTACCAAGACAGCTGCAGTGGCGCGGCCAGAAAGCTCCAACAAGTCAAGAGATGAG
GCTAATGGGCCGACGGCGGCGACCTTGGGAGGCGTGCTGAAATGGGAGAAACCATATCAACCTCTACAGCCGGGC
CAGACTCAATCTATCGGGCAGTCGTCGCCTCAAGTAGCCACCTCTAGTGGGCCACAGAAGAACCAGCAGCAGCAG
CAGCAGCAGTTACAGCAACAACAACAGCAACAGCAGCAGCAGAAGCAGCTACAACAGCAACAGCAACAGCAGCAG
CAACAACAGCCGCAACAACAGCCGCAACAACAGCAGCAACAACAGCAACAACAACAGCAACAGCAGCTACAGCAG
CAAAAACAACAGCTACAGCAGCAAAAACAACAGCTACAGCAGCAAAAACAACAGCTACAGCAACAACAACAACAA
CAACAGCAACGACAACAGTGGCAAAATTCACAGCAGCAACAGCAGCAGACACCATCGCAGCCACAAGCATCCAAA
CGGCCGCACAAGCTACATACCCCGCAACAAACATTGAAACAGCCCCAGAAGCAAACGGCACCACAGCAACAGCAA
GAGCAGCAGATTCAGCCCTCTGTACAGTTCCTTGGGCAAACATCTGGCCCGCCACCGCGACCTCGCTCACCTCGT
GTGGATCCTGTCTTTGCTCCCTCTCCTCAAGCTCCCCAACAGGTGACTGCGCTTGTGCAGCCGTGCTCTCCTCAT
CCTGTAGGAGGCACTTCTTCACCAGTGACAAATGCTTCACTCTGTCGGCCTCAGCCTGTGGCACCTGTCGTGTCC
CCTGGGCTTGGGCTAGCAGTCCACTCGCAACAACATCAGCAGCCTCAAGAACAACGGCAGCAGCAACCTTCATCT
CAATCTCGACCGCAAACTCAGCCCCAACCTCAACCACAGCAACAGCAGGCAACCAAGCCCTCACAACAGCAGATG
CTACGCCCCATAGCTTTAGCTCCTCCATTATCCGAACCTATGCCTTCACCCTCATTAAAACAGTCTCAGAATTCA
GCAACGACACAACCAGGACAACGCGCGCCATCTGTCGCACAGCCTTCGCTCGCAAATCAATCCAATAGGTCGAAT
GAAGCACATGTACCATCATATTCCTATCAGGCCCCCAAACCAATGGTATCCGAATTTGTTCGACAGGCAACAGAA
GCTCCAGGAGTCGGGCATGCTAGTTCTGGGATTAATCCTCAAACTCCTCGACCTGTCGGTCCGATAGCGTTCGCG
CGAGGTCTTGGAACGAAATGGGCCCCCAAGTCAACGCCATCGACTCCAAGGCCTACGGCTGTCGAGCCTGAGAGC
CCTGCTTATGAACCTGCCAGTCCCAGACTTGCACGGCGTCCCCCTTCTCGACCGCCTTCAACTCCTGCTGATACT
CCCAGAAATACTGTGAGAAAGGTTATGCCAAAGCCTTCCTACCACTCAGATATCATGGCCTCACGGCGCCGCAGT
CGAGGTGGGGGGGAGACTGGAGCCATTGCTATGACATCTTCTTCGCGTCCTGCAAGACGTAGCCCTTCTGTTGCA
TCGCAAACAGATGAGCTGTCGTTGGATCATTCTGCCTTTTCTACCAGGGTCAAGCGGGAGGCAATGACACCTCGA
GCGCATGATGATGCAGGAGACACTACAGCCGACGAGAGCATTCTAGGTCGAACGCACATGGTGACGCCTGGTAGC
GTAACGTCGCGACTGGCCAAGAGAAAGAGGCCGGAATCGCCCAACGGTGGACTGACACCCCCAACACAGGTGTTG
TGGACTCGGGGATTTACCAAGGTTTCGTCGTCGGCCCTTGATCAGATTTCAAGCCATCGTCATGCAAACATGTTT
GCAACGGGTGTACGAGAGAAGGATGCGCCAAATTACCGGCAGATTGTGCTTCAACCCCAGGACATCACGTCGATT
CGAGCGGCGATCAAGCAGGGAAATAAGGCGGCTATGCAGGCTGCTAGCTGTCTACCGGGAGGCGGTGACCCAGGG
ACGGCCAATGTGTGGCTACCAATATCTGAGGATCTGGTGCCTCCTCGAGGCATCATCAATAGCGCGCAGTTGGAA
AGAGAATTGGTGCACATCTTTTGCAACGCCATCATGTATAATCCGGATCCGAACCGCGGACCTGGCCCGGCCTTT
ATGAAGCGATCTACAGATGAGGAGGAAGAGGTGGTGGGCTACCATCTCGATGAAAACGGCGTTGTCAAGAATACC
CGCAGTATGTTTGTCGAGGTGGAAAAGCTCTTGGGCGAACTCCGAAGTGCGGAAAAGGATCGTGGGGTGCCAGCT
ATGCGCCAGATTAGTGTTTCGCCAGCTGACGACTCGGCCGAGGATGAAGACGAACTGGCAGGCGATGGAGGCATT
TCTGGAGCTACGTTTGGTAAAAGACGACGTGTGAGTATGCGGTCAAGTATTAGCCAGCAGCCTTCTTCTTCTGTT
AAAGCTCCACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail