Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4072
Gene name
LocationContig_266:2755..4497
Strand+
Gene length (bp)1742
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10521 Tti2 Tti2 family 1.5E-57 120 373

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6391
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5664
Ophiocordyceps australis map64 (Brazil) OphauB2|4072 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05620
Ophiocordyceps camponoti-rufipedis Ophun1|1529
Ophiocordyceps kimflemingae Ophio5|8621

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4072
MTETLVGQANRDRLLHIGVLKTCPQDIINLDDDARSISTAHNDTNRRDAVLCAFHRLGGDWQKSDSIEQAVPNLV
SSLVPILSLANVTDFDGQALIAEAALACLELLSASPYCLLDDPTLLLIISYTNTNDAWTTSFSCLLAARLLESRL
LDDNLAQFIVGPVLKSYIRPKLSHSRSTTMSSGTTSNDWMQSDPSIPTIFGWSVEKANAALLSQEWPLYLPVLLA
LIENSQLTVRTRGLDILVTFIQKCSHNTLFSTGISRVLEDAIFPTLFFLPSLTPEHDSAILLDLAYTALLKLAAA
DSNPQSHARRRLLDRLIRHGIMAGYLHGSNYPAVVKVLMRSATAAISLLGFSAIKHIQDLVDILDSTMTDPFSPS
YPSVAAAAGQVLDVLISHCWPRLVGTRHTRRILAILVACWLNVREKMEELAEPSSAQDLYSLSQQVVVLCKHLRA
VSPHKDLKIPSTLNDALSRHLQLAPLFGDCESLQPADGA*
Coding >OphauB2|4072
ATGACTGAAACACTTGTAGGCCAAGCAAACAGAGACCGCCTCCTACATATTGGCGTACTCAAGACGTGCCCCCAA
GACATTATTAATCTGGATGACGATGCTCGAAGCATCTCGACTGCGCACAACGATACTAATCGTCGCGATGCAGTC
CTGTGCGCCTTTCATAGACTAGGCGGGGACTGGCAGAAGTCAGACTCAATCGAGCAAGCCGTCCCGAACCTCGTC
AGCTCTCTTGTCCCCATTTTATCCCTCGCCAATGTCACCGACTTTGACGGCCAGGCTCTCATTGCCGAGGCAGCA
TTAGCATGCCTAGAGCTGCTATCGGCCTCACCATACTGTCTTCTTGATGACCCAACACTCCTACTCATCATTTCC
TACACCAACACTAACGATGCCTGGACTACCTCTTTTTCGTGCCTCTTGGCTGCTAGGCTGCTAGAATCTCGCCTT
TTGGACGATAACCTTGCTCAGTTCATTGTCGGACCAGTCTTGAAGTCGTATATACGCCCAAAGCTTTCACATTCA
AGGTCAACAACTATGAGCTCCGGGACAACCTCGAACGATTGGATGCAGAGTGACCCTTCCATACCAACAATCTTC
GGTTGGAGTGTCGAAAAAGCCAATGCAGCTTTGCTTTCCCAGGAATGGCCACTCTACCTGCCTGTCCTACTTGCT
CTTATCGAAAACTCGCAGTTGACTGTGAGGACAAGAGGTCTCGATATCCTAGTCACTTTCATACAAAAATGCTCA
CACAATACGCTATTCTCGACGGGAATTTCTCGAGTCCTCGAGGATGCCATTTTTCCAACTCTATTCTTCTTGCCA
AGTTTGACGCCGGAGCATGACTCGGCTATTTTGCTAGACCTGGCCTATACAGCACTCTTGAAGCTGGCAGCAGCA
GACTCGAACCCTCAGAGCCATGCGAGAAGACGCTTGCTAGACAGGCTTATTCGACATGGTATAATGGCTGGCTAT
TTGCATGGTTCCAACTACCCCGCAGTTGTCAAGGTGTTGATGCGGAGCGCCACAGCTGCCATTTCGTTGCTCGGC
TTCTCTGCCATTAAACACATACAGGATCTTGTTGACATTTTAGATTCCACCATGACAGATCCCTTCAGCCCAAGC
TACCCTTCTGTTGCTGCGGCTGCTGGTCAAGTTTTGGATGTTCTGATTTCTCATTGTTGGCCCAGGCTAGTTGGC
ACTCGCCATACCAGACGCATCCTCGCTATTCTAGTCGCCTGCTGGCTTAATGTGCGCGAAAAAATGGAGGAGCTT
GCGGAGCCCTCGTCGGCCCAGGACTTGTACTCCCTGTCTCAACAAGTCGTGGTCTTATGCAAACACCTACGGGCC
GTATCGCCGCACAAAGACCTCAAGATTCCCAGCACACTCAACGACGCTCTGTCGAGGCATTTGCAACTCGCGCCC
CTATTTGGCGACTGTGAGTCTTTGCAGCCGGCAGACGGCGCATAA
Transcript >OphauB2|4072
ATGACTGAAACACTTGTAGGCCAAGCAAACAGAGACCGCCTCCTACATATTGGCGTACTCAAGACGTGCCCCCAA
GACATTATTAATCTGGATGACGATGCTCGAAGCATCTCGACTGCGCACAACGATACTAATCGTCGCGATGCAGTC
CTGTGCGCCTTTCATAGACTAGGCGGGGACTGGCAGAAGTCAGACTCAATCGAGCAAGCCGTCCCGAACCTCGTC
AGCTCTCTTGTCCCCATTTTATCCCTCGCCAATGTCACCGACTTTGACGGCCAGGCTCTCATTGCCGAGGCAGCA
TTAGCATGCCTAGAGCTGCTATCGGCCTCACCATACTGTCTTCTTGATGACCCAACACTCCTACTCATCATTTCC
TACACCAACACTAACGATGCCTGGACTACCTCTTTTTCGTGCCTCTTGGCTGCTAGGCTGCTAGAATCTCGCCTT
TTGGACGATAACCTTGCTCAGTTCATTGTCGGACCAGTCTTGAAGTCGTATATACGCCCAAAGCTTTCACATTCA
AGGTCAACAACTATGAGCTCCGGGACAACCTCGAACGATTGGATGCAGAGTGACCCTTCCATACCAACAATCTTC
GGTTGGAGTGTCGAAAAAGCCAATGCAGCTTTGCTTTCCCAGGAATGGCCACTCTACCTGCCTGTCCTACTTGCT
CTTATCGAAAACTCGCAGTTGACTGTGAGGACAAGAGGTCTCGATATCCTAGTCACTTTCATACAAAAATGCTCA
CACAATACGCTATTCTCGACGGGAATTTCTCGAGTCCTCGAGGATGCCATTTTTCCAACTCTATTCTTCTTGCCA
AGTTTGACGCCGGAGCATGACTCGGCTATTTTGCTAGACCTGGCCTATACAGCACTCTTGAAGCTGGCAGCAGCA
GACTCGAACCCTCAGAGCCATGCGAGAAGACGCTTGCTAGACAGGCTTATTCGACATGGTATAATGGCTGGCTAT
TTGCATGGTTCCAACTACCCCGCAGTTGTCAAGGTGTTGATGCGGAGCGCCACAGCTGCCATTTCGTTGCTCGGC
TTCTCTGCCATTAAACACATACAGGATCTTGTTGACATTTTAGATTCCACCATGACAGATCCCTTCAGCCCAAGC
TACCCTTCTGTTGCTGCGGCTGCTGGTCAAGTTTTGGATGTTCTGATTTCTCATTGTTGGCCCAGGCTAGTTGGC
ACTCGCCATACCAGACGCATCCTCGCTATTCTAGTCGCCTGCTGGCTTAATGTGCGCGAAAAAATGGAGGAGCTT
GCGGAGCCCTCGTCGGCCCAGGACTTGTACTCCCTGTCTCAACAAGTCGTGGTCTTATGCAAACACCTACGGGCC
GTATCGCCGCACAAAGACCTCAAGATTCCCAGCACACTCAACGACGCTCTGTCGAGGCATTTGCAACTCGCGCCC
CTATTTGGCGACTGTGAGTCTTTGCAGCCGGCAGACGGCGCATAA
Gene >OphauB2|4072
ATGACTGAAACACTTGTAGGCCAAGCAAACAGAGACCGCCTCCTACATATTGGCGTACTCAAGACGTGCCCCCAA
GACATTATTAATCTGGATGACGATGCTCGAAGCATCTCGACTGCGCACAACGATACTGTACTTTCTCCCCTCGTT
TAATTGTATAGACTGTATTTCTGATATCAACATGACTCTTTATCTTGGACTTTATAGAATCGTCGCGATGCAGTC
CTGTGCGCCTTTCATAGACTAGGCGGGGACTGGCAGAAGTCAGACTCAATCGAGCAAGCCGTCCCGAACCTCGTC
AGCTCTCTTGTCCCCATTTTATCCCTCGCCAATGTCACCGGTATCTCTTGCTCCAACTTGCATCAGTCTCATGGC
TTCTCATAACTTACCCGTGCGTCGTGCGGCTAGACTTTGACGGCCAGGCTCTCATTGCCGAGGCAGCATTAGCAT
GCCTAGAGCTGCTATCGGCCTCACCATACTGTCTTCTTGATGACCCAACACTCCTACTCATCATTTCCTACACCA
ACACTAACGATGCCTGGACTACCTCTTTTTCGTGCCTCTTGGCTGCTAGGCTGCTAGAATCTCGCCTTTTGGACG
ATAACCTTGCTCAGTTCATTGTCGGACCAGTCTTGAAGTCGTATATACGCCCAAAGCTTTCACATTCAAGGTCAA
CAACTATGAGCTCCGGGACAACCTCGAACGATTGGATGCAGAGTGACCCTTCCATACCAACAATCTTCGGTTGGA
GTGTCGAAAAAGCCAATGTCAGTGGTTCACCATCTTCGTGAGTCCATATCCATAAACTAACAATGGAGCAAATAG
GCAGCTTTGCTTTCCCAGGAATGGCCACTCTACCTGCCTGTCCTACTTGCTCTTATCGAAAACTCGCAGTTGACT
GTGAGGACAAGAGGTCTCGATATCCTAGTCACTTTCATACAAAAATGCTCACACAATACGCTATTCTCGACGGGA
ATTTCTCGAGTCCTCGAGGATGCCATTTTTCCAACTCTATTCTTCTTGCCAAGTTTGACGCCGGAGCATGACTCG
GCTATTTTGCTAGACCTGGCCTATACAGCACTCTTGAAGCTGGCAGCAGCAGACTCGAACCCTCAGAGCCATGCG
AGAAGACGCTTGCTAGACAGGCTTATTCGACATGGTATAATGGCTGGCTATTTGCATGGTTCCAACTACCCCGCA
GTTGTCAAGGTGTTGATGCGGAGCGCCACAGCTGCCATTTCGTTGCTCGGCTTCTCTGCCATTAAACACATACAG
GTCATGCGATCCATACCAGAGCTACGTCATTCATGTGTGCGTTTACATGCTAACAATGTCTTGCTTAATAGGATC
TTGTTGACATTTTAGATTCCACCATGACAGATCCCTTCAGCCCAAGCTACCCTTCTGTTGCTGCGGCTGCTGGTC
AAGTTTTGGATGTTCTGATTTCTCATTGTTGGCCCAGGCTAGTTGGCACTCGCCATACCAGACGCATCCTCGCTA
TTCTAGTCGCCTGCTGGCTTAATGTGCGCGAAAAAATGGAGGAGCTTGCGGAGCCCTCGTCGGCCCAGGACTTGT
ACTCCCTGTCTCAACAAGTCGTGGTCTTATGCAAACACCTACGGGCCGTATCGCCGCACAAAGACCTCAAGATTC
CCAGCACACTCAACGACGCTCTGTCGAGGCATTTGCAACTCGCGCCCCTATTTGGCGACTGTGAGTCTTTGCAGC
CGGCAGACGGCGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail