Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4063
Gene name
LocationContig_263:82..2582
Strand+
Gene length (bp)2500
Transcript length (bp)2190
Coding sequence length (bp)2190
Protein length (aa) 730

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 4.7E-14 351 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 181 729 3.0E-99
sp|Q4WZV6|XLNR_ASPFU Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnR PE=3 SV=1 181 729 1.0E-97
sp|B0XUL1|XLNR_ASPFC Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnR PE=3 SV=1 181 729 2.0E-97
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 198 729 5.0E-97
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 198 729 4.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 181 729 3.0E-99
sp|Q4WZV6|XLNR_ASPFU Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnR PE=3 SV=1 181 729 1.0E-97
sp|B0XUL1|XLNR_ASPFC Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnR PE=3 SV=1 181 729 2.0E-97
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 198 729 5.0E-97
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 198 729 4.0E-95
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 198 729 4.0E-95
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 181 729 1.0E-94
sp|A2R5W7|XLNR_ASPNC Xylanolytic transcriptional activator xlnR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnR PE=3 SV=2 181 729 8.0E-94
sp|Q96WP8|XLNR_ASPKA Xylanolytic transcriptional activator xlnR OS=Aspergillus kawachii GN=xlnR PE=3 SV=2 181 729 4.0E-92
sp|A1C7P9|XLNR_ASPCL Xylanolytic transcriptional activator xlnR OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnR PE=3 SV=2 181 729 1.0E-91
sp|A2QJX5|ARAR_ASPNC Arabinanolytic transcriptional activator araR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=araR PE=3 SV=1 4 729 4.0E-77
sp|Q5BGE2|ARAR_EMENI Arabinolytic transcriptional activator araR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0388 PE=3 SV=1 6 729 1.0E-72
sp|G4MZJ4|XLNR_MAGO7 Xylanolytic transcriptional activator xlnR homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=xlr1 PE=3 SV=1 198 538 9.0E-48
sp|G4MZJ4|XLNR_MAGO7 Xylanolytic transcriptional activator xlnR homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=xlr1 PE=3 SV=1 561 729 8.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0008152 metabolic process No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044249 cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 626 648 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4063
MADASPCRRCQDYGYSCRYNREVKKRGRLPASARLDSAASPPEAKHVRLESEAAAGKHHDDDDDDDDDDERQALP
PPRIHAMSIPSLTHAGIPRPRPESAESTLHAASPPGPFGGLPPPPPPPPRVGPSPHDADVLVSDESVGYPSPAGL
SDLRRRRTSFRSAASNERNVRASVSTPTTAADFVPDASLRAPTEDCHYRFLDPVLPFIRRIIPASVACELLDIFL
TDPGSSLFRGASPYILTRVFRKRSITHPSSPRYTTPALLATILWCVAQTADVMLLHVPGTRARVVNDLYDLATSL
VSERDPDRWRRIHGGLRAESEVPHPSLASPAVPTTTAANEPAGLVDDVLTFILLSIAVSGGDFKSDCYKWWSKAV
RLALSLRLNREDERCSASVSPCANPLCSCHRDTQDASLVQFERREERRRVFWLLYSLDRHLSLSFNTVLSMPDSY
CEVFAPLPEVVWESLDAIAPKDLPLRTMGPPTLASGTGFFEYFLPLMAILGDIIEVHHRRRHPRLGGQNDAHSVA
IVKELLASYELSLSSLSSSNYPYGPHGPAGPADHSRVRLVRAYSAHILHVLHVLLHGKWDAISMLDDGDDWITSP
RFTECAAHAISASQTVSTILTIDPELTFMSYLFGIYLLQGSFILLLFADRMPQLGPNESVEQACENIIRAHEVCV
VTLSTEFQKNFRKVVRSTLYSVRGSGTTNWDEHRARRRALSLYRWTKGARGLAL*
Coding >OphauB2|4063
ATGGCCGATGCAAGCCCGTGTCGCCGGTGCCAAGACTATGGATACTCGTGCCGCTATAACCGCGAGGTCAAGAAA
CGAGGCCGGCTGCCCGCCTCAGCGCGCCTCGATTCGGCCGCGTCGCCGCCCGAGGCCAAGCATGTGCGGCTCGAA
TCCGAGGCGGCGGCCGGCAAGCACCACGACGACGACGACGACGACGACGACGACGACGAGCGCCAGGCTCTGCCG
CCGCCGCGCATCCATGCCATGTCGATTCCGTCGCTGACGCATGCCGGCATTCCGCGCCCGCGCCCCGAGTCGGCC
GAGTCGACTTTGCACGCCGCGTCGCCTCCGGGGCCCTTTGGAGGCCTGCCGCCGCCGCCGCCGCCGCCGCCACGA
GTCGGACCGTCTCCGCACGACGCCGATGTGCTTGTTTCCGACGAGAGCGTGGGATATCCGTCGCCGGCCGGGCTG
TCCGATCTGAGGCGGCGGCGCACGTCGTTTCGGTCGGCGGCCAGCAATGAGCGCAATGTGCGGGCTTCCGTCAGC
ACGCCCACCACTGCCGCCGACTTTGTGCCCGACGCCTCGTTGCGCGCGCCCACTGAAGACTGCCACTATCGCTTC
CTCGACCCCGTGCTGCCCTTTATCCGGCGCATCATTCCCGCGTCGGTGGCCTGCGAGCTGCTCGACATCTTTCTC
ACTGACCCCGGCAGCTCCCTCTTCCGCGGCGCATCGCCCTATATCCTGACGCGCGTCTTTCGCAAGCGCTCCATT
ACCCATCCCTCGAGCCCGCGCTACACCACGCCCGCCCTGCTCGCCACCATTTTGTGGTGTGTTGCCCAGACGGCC
GACGTGATGCTGCTGCACGTGCCCGGAACCAGGGCGCGAGTCGTCAACGACCTCTACGACTTGGCCACGTCGCTC
GTCTCGGAGCGCGATCCCGACCGCTGGCGGCGCATCCACGGCGGCCTGCGCGCCGAGAGCGAGGTGCCACACCCG
AGCCTGGCCAGCCCGGCAGTGCCCACCACAACCGCCGCCAATGAGCCCGCCGGCCTGGTGGACGATGTCCTCACC
TTTATCCTGCTGTCCATTGCCGTGTCGGGAGGCGACTTCAAGTCGGACTGCTACAAGTGGTGGTCCAAGGCTGTG
CGCCTGGCGCTGTCGCTGCGCCTCAACCGCGAGGATGAGCGCTGCTCGGCCTCTGTCTCTCCTTGCGCCAACCCC
TTGTGCTCATGCCATCGCGATACGCAGGATGCCAGCCTGGTGCAGTTTGAGCGCCGTGAGGAGCGGCGGCGTGTC
TTTTGGCTGCTCTACAGCCTGGACCGCCACCTGAGCCTCTCCTTCAACACGGTGCTCTCCATGCCCGACTCTTAC
TGCGAAGTCTTTGCGCCGCTGCCCGAGGTTGTATGGGAAAGCCTGGATGCCATTGCGCCCAAGGACCTGCCGCTA
CGCACCATGGGCCCGCCCACGCTGGCCAGCGGCACCGGCTTCTTTGAGTATTTCTTGCCCCTCATGGCCATTCTC
GGCGACATCATCGAGGTGCACCATCGGCGACGGCATCCTCGCCTGGGCGGGCAAAACGACGCGCACTCGGTGGCC
ATTGTCAAGGAGCTGCTGGCCAGCTACGAGCTGAGCCTCTCGTCGCTCAGCAGCTCAAACTATCCCTACGGCCCC
CACGGCCCGGCCGGCCCTGCCGACCACTCGCGCGTGCGGCTGGTGCGGGCATACAGCGCCCATATCCTCCACGTG
CTGCACGTCTTGCTGCACGGCAAGTGGGATGCCATTTCCATGCTCGACGACGGCGACGACTGGATCACGTCGCCG
CGCTTCACCGAGTGTGCCGCCCACGCCATTTCCGCCTCGCAGACCGTGTCCACCATTCTCACCATTGATCCCGAG
CTGACCTTTATGTCTTATTTGTTTGGCATATATCTGCTGCAGGGCAGTTTTATCCTGCTCTTGTTTGCAGACCGC
ATGCCGCAGCTCGGGCCAAACGAGTCTGTCGAGCAGGCTTGTGAAAACATAATCCGCGCCCACGAGGTTTGCGTC
GTGACTCTGAGTACCGAGTTTCAGAAAAACTTTCGCAAAGTGGTGCGGTCGACGCTCTATAGCGTGCGCGGATCG
GGCACGACGAATTGGGACGAGCACCGCGCGCGCCGACGCGCTCTGTCTCTCTACAGGTGGACCAAGGGTGCTCGA
GGCCTGGCATTGTAA
Transcript >OphauB2|4063
ATGGCCGATGCAAGCCCGTGTCGCCGGTGCCAAGACTATGGATACTCGTGCCGCTATAACCGCGAGGTCAAGAAA
CGAGGCCGGCTGCCCGCCTCAGCGCGCCTCGATTCGGCCGCGTCGCCGCCCGAGGCCAAGCATGTGCGGCTCGAA
TCCGAGGCGGCGGCCGGCAAGCACCACGACGACGACGACGACGACGACGACGACGACGAGCGCCAGGCTCTGCCG
CCGCCGCGCATCCATGCCATGTCGATTCCGTCGCTGACGCATGCCGGCATTCCGCGCCCGCGCCCCGAGTCGGCC
GAGTCGACTTTGCACGCCGCGTCGCCTCCGGGGCCCTTTGGAGGCCTGCCGCCGCCGCCGCCGCCGCCGCCACGA
GTCGGACCGTCTCCGCACGACGCCGATGTGCTTGTTTCCGACGAGAGCGTGGGATATCCGTCGCCGGCCGGGCTG
TCCGATCTGAGGCGGCGGCGCACGTCGTTTCGGTCGGCGGCCAGCAATGAGCGCAATGTGCGGGCTTCCGTCAGC
ACGCCCACCACTGCCGCCGACTTTGTGCCCGACGCCTCGTTGCGCGCGCCCACTGAAGACTGCCACTATCGCTTC
CTCGACCCCGTGCTGCCCTTTATCCGGCGCATCATTCCCGCGTCGGTGGCCTGCGAGCTGCTCGACATCTTTCTC
ACTGACCCCGGCAGCTCCCTCTTCCGCGGCGCATCGCCCTATATCCTGACGCGCGTCTTTCGCAAGCGCTCCATT
ACCCATCCCTCGAGCCCGCGCTACACCACGCCCGCCCTGCTCGCCACCATTTTGTGGTGTGTTGCCCAGACGGCC
GACGTGATGCTGCTGCACGTGCCCGGAACCAGGGCGCGAGTCGTCAACGACCTCTACGACTTGGCCACGTCGCTC
GTCTCGGAGCGCGATCCCGACCGCTGGCGGCGCATCCACGGCGGCCTGCGCGCCGAGAGCGAGGTGCCACACCCG
AGCCTGGCCAGCCCGGCAGTGCCCACCACAACCGCCGCCAATGAGCCCGCCGGCCTGGTGGACGATGTCCTCACC
TTTATCCTGCTGTCCATTGCCGTGTCGGGAGGCGACTTCAAGTCGGACTGCTACAAGTGGTGGTCCAAGGCTGTG
CGCCTGGCGCTGTCGCTGCGCCTCAACCGCGAGGATGAGCGCTGCTCGGCCTCTGTCTCTCCTTGCGCCAACCCC
TTGTGCTCATGCCATCGCGATACGCAGGATGCCAGCCTGGTGCAGTTTGAGCGCCGTGAGGAGCGGCGGCGTGTC
TTTTGGCTGCTCTACAGCCTGGACCGCCACCTGAGCCTCTCCTTCAACACGGTGCTCTCCATGCCCGACTCTTAC
TGCGAAGTCTTTGCGCCGCTGCCCGAGGTTGTATGGGAAAGCCTGGATGCCATTGCGCCCAAGGACCTGCCGCTA
CGCACCATGGGCCCGCCCACGCTGGCCAGCGGCACCGGCTTCTTTGAGTATTTCTTGCCCCTCATGGCCATTCTC
GGCGACATCATCGAGGTGCACCATCGGCGACGGCATCCTCGCCTGGGCGGGCAAAACGACGCGCACTCGGTGGCC
ATTGTCAAGGAGCTGCTGGCCAGCTACGAGCTGAGCCTCTCGTCGCTCAGCAGCTCAAACTATCCCTACGGCCCC
CACGGCCCGGCCGGCCCTGCCGACCACTCGCGCGTGCGGCTGGTGCGGGCATACAGCGCCCATATCCTCCACGTG
CTGCACGTCTTGCTGCACGGCAAGTGGGATGCCATTTCCATGCTCGACGACGGCGACGACTGGATCACGTCGCCG
CGCTTCACCGAGTGTGCCGCCCACGCCATTTCCGCCTCGCAGACCGTGTCCACCATTCTCACCATTGATCCCGAG
CTGACCTTTATGTCTTATTTGTTTGGCATATATCTGCTGCAGGGCAGTTTTATCCTGCTCTTGTTTGCAGACCGC
ATGCCGCAGCTCGGGCCAAACGAGTCTGTCGAGCAGGCTTGTGAAAACATAATCCGCGCCCACGAGGTTTGCGTC
GTGACTCTGAGTACCGAGTTTCAGAAAAACTTTCGCAAAGTGGTGCGGTCGACGCTCTATAGCGTGCGCGGATCG
GGCACGACGAATTGGGACGAGCACCGCGCGCGCCGACGCGCTCTGTCTCTCTACAGGTGGACCAAGGGTGCTCGA
GGCCTGGCATTGTAA
Gene >OphauB2|4063
ATGGCCGATGCAAGCCCGTGTCGCCGGTGCCAAGGTAAGGGAAAAAAAGAATTCCGAGTTTTCCGCATTGGCTGG
GCATTTTGAATGCTTGCTTTTTTTTTTGCGTTGCCTTTGGGGGTTTTTGCATGGGCGGCTCATTGAGGCTGTAGA
CTATGGATACTCGTGCCGCTATAACCGCGAGGTCAAGAAACGAGGCCGGCTGCCCGCCTCAGCGTGCGTCATGCC
TCTCCGCGACGGGGCTAGTCTGACAGATTGCGCAGGCGCCTCGATTCGGCCGCGTCGCCGCCCGAGGCCAAGCAT
GTGCGGCTCGAATCCGAGGCGGCGGCCGGCAAGCACCACGACGACGACGACGACGACGACGACGACGACGAGCGC
CAGGCTCTGCCGCCGCCGCGCATCCATGCCATGTCGATTCCGTCGCTGACGCATGCCGGCATTCCGCGCCCGCGC
CCCGAGTCGGCCGAGTCGACTTTGCACGCCGCGTCGCCTCCGGGGCCCTTTGGAGGCCTGCCGCCGCCGCCGCCG
CCGCCGCCACGAGTCGGACCGTCTCCGCACGACGCCGATGTGCTTGTTTCCGACGAGAGCGTGGGATATCCGTCG
CCGGCCGGGCTGTCCGATCTGAGGCGGCGGCGCACGTCGTTTCGGTCGGCGGCCAGCAATGAGCGCAATGTGCGG
GCTTCCGTCAGCACGCCCACCACTGCCGCCGACTTTGTGCCCGACGCCTCGTTGCGCGCGCCCACTGAAGACTGC
CACTATCGCTTCCTCGACCCCGTGCTGCCCTTTATCCGGCGCATCATTCCCGCGTCGGTGGCCTGCGAGCTGCTC
GACATCTTTCTCACTGACCCCGGCAGCTCCCTCTTCCGCGGCGCATCGCCCTATATCCTGACGCGCGTCTTTCGC
AAGCGCTCCATTACCCATCCCTCGAGCCCGCGCTACACCACGCCCGCCCTGCTCGCCACCATTTTGTGGTGTGTT
GCCCAGACGGCCGACGTGATGCTGCTGCACGTGCCCGGAACCAGGGCGCGAGTCGTCAACGACCTCTACGACTTG
GCCACGTCGCTCGTCTCGGAGCGCGATCCCGACCGCTGGCGGCGCATCCACGGCGGCCTGCGCGCCGAGAGCGAG
GTGCCACACCCGAGCCTGGCCAGCCCGGCAGTGCCCACCACAACCGCCGCCAATGAGCCCGCCGGCCTGGTGGAC
GATGTCCTCACCTTTATCCTGCTGTCCATTGCCGTGTCGGGAGGCGACTTCAAGTCGGACTGCTACAAGTGGTGG
TCCAAGGCTGTGCGCCTGGCGCTGTCGCTGCGCCTCAACCGCGAGGATGAGCGCTGCTCGGCCTCTGTCTCTCCT
TGCGCCAACCCCTTGTGCTCATGCCATCGCGATACGCAGGATGCCAGCCTGGTGCAGTTTGAGCGCCGTGAGGAG
CGGCGGCGTGTCTTTTGGCTGCTCTACAGCCTGGACCGCCACCTGAGCCTCTCCTTCAACACGGTGCTCTCCATG
CCCGACTCTTACTGCGAAGTCTTTGGTGAGTTTTGGCAGTCCTGATGCTACTACACCAAGAGACTGACGAGGCCA
GCGCCGCTGCCCGAGGTTGTATGGGAAAGCCTGGATGCCATTGCGCCCAAGGACCTGCCGCTACGCACCATGGGC
CCGCCCACGCTGGCCAGCGGCACCGGCTTCTTTGAGTATTTCTTGCCCCTCATGGCCATTCTCGGCGACATCATC
GAGGTGCACCATCGGCGACGGCATCCTCGCCTGGGCGGGCAAAACGACGCGCACTCGGTGGCCATTGTCAAGGAG
CTGCTGGCCAGCTACGAGCTGAGCCTCTCGTCGCTCAGCAGCTCAAACTATCCCTACGGCCCCCACGGCCCGGCC
GGCCCTGCCGACCACTCGCGCGTGCGGCTGGTGCGGGCATACAGCGCCCATATCCTCCACGTGCTGCACGTCTTG
CTGCACGGCAAGTGGGATGCCATTTCCATGCTCGACGACGGCGACGACTGGATCACGTCGCCGCGCTTCACCGAG
TGTGCCGCCCACGCCATTTCCGCCTCGCAGACCGTGTCCACCATTCTCACCATTGATCCCGAGCTGACCTTTATG
TCTTATTTGTTTGGCATATATCTGCTGCAGGGCAGTTTTATCCTGCTCTTGTTTGCAGACCGCATGCCGCAGCTC
GGGCCAAACGAGTCTGTCGAGCAGGCTTGTGAAAACATAATCCGCGCCCACGAGGTTTGCGTCGTGACTCTGAGT
ACCGAGTTTCAGGCAAGTTTTTCCCCCTCTTTTTAAGCCTTGTCAAGGCTTCTTGTTGAATTGACGGCTTCTTTC
AAGAGGGCCCCTGGCTGACGGCGTGTGCGTGTAGAAAAACTTTCGCAAAGTGGTGCGGTCGACGCTCTATAGCGT
GCGCGGATCGGGCACGACGAATTGGGACGAGCACCGCGCGCGCCGACGCGCTCTGTCTCTCTACAGGTGGACCAA
GGGTGCTCGAGGCCTGGCATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail