Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4054
Gene name
LocationContig_261:9179..10418
Strand+
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04034 Ribo_biogen_C Ribosome biogenesis protein, C-terminal 4.2E-48 69 196
PF04068 RLI Possible Fer4-like domain in RNase L inhibitor, RLI 2.6E-10 32 63

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12094|TSR3_YEAST Ribosome biogenesis protein TSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR3 PE=1 SV=1 2 222 5.0E-73
sp|Q10409|TSR3_SCHPO Ribosome biogenesis protein tsr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr3 PE=3 SV=1 3 311 1.0E-71
sp|Q9UJK0|TSR3_HUMAN Ribosome biogenesis protein TSR3 homolog OS=Homo sapiens GN=TSR3 PE=1 SV=1 14 241 1.0E-54
sp|Q5HZH2|TSR3_MOUSE Ribosome biogenesis protein TSR3 homolog OS=Mus musculus GN=Tsr3 PE=1 SV=1 34 232 4.0E-51
sp|Q12ZL9|TSR3_METBU Probable ribosome biogenesis protein Mbur_0088 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_0088 PE=3 SV=1 41 196 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12094|TSR3_YEAST Ribosome biogenesis protein TSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR3 PE=1 SV=1 2 222 5.0E-73
sp|Q10409|TSR3_SCHPO Ribosome biogenesis protein tsr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr3 PE=3 SV=1 3 311 1.0E-71
sp|Q9UJK0|TSR3_HUMAN Ribosome biogenesis protein TSR3 homolog OS=Homo sapiens GN=TSR3 PE=1 SV=1 14 241 1.0E-54
sp|Q5HZH2|TSR3_MOUSE Ribosome biogenesis protein TSR3 homolog OS=Mus musculus GN=Tsr3 PE=1 SV=1 34 232 4.0E-51
sp|Q12ZL9|TSR3_METBU Probable ribosome biogenesis protein Mbur_0088 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_0088 PE=3 SV=1 41 196 6.0E-29
sp|Q469W0|TSR3_METBF Probable ribosome biogenesis protein Mbar_A2412 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A2412 PE=3 SV=1 39 196 1.0E-28
sp|Q8TMY6|TSR3_METAC Probable ribosome biogenesis protein MA_2508 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_2508 PE=3 SV=1 39 196 1.0E-27
sp|Q8PSK5|TSR3_METMA Probable ribosome biogenesis protein MM_3074 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3074 PE=3 SV=1 39 196 1.0E-26
sp|Q2NET3|TSR3_METST Probable ribosome biogenesis protein Msp_1293 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=Msp_1293 PE=3 SV=1 31 196 8.0E-26
sp|Q8TXM4|TSR3_METKA Probable ribosome biogenesis protein MK0638 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0638 PE=3 SV=1 41 196 5.0E-24
sp|Q97CM6|TSR3_THEVO Probable ribosome biogenesis protein TV0075 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0075 PE=3 SV=1 42 196 2.0E-23
sp|Q9UWV6|TSR3_SULSO Probable ribosome biogenesis protein SSO0551 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0551 PE=3 SV=2 31 199 5.0E-23
sp|Q58118|TSR3_METJA Probable ribosome biogenesis protein MJ0708 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0708 PE=3 SV=1 39 198 7.0E-23
sp|Q9HNJ6|TSR3_HALSA Probable ribosome biogenesis protein VNG_2075C OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_2075C PE=3 SV=3 39 196 9.0E-23
sp|B0R700|TSR3_HALS3 Probable ribosome biogenesis protein OE_3895F OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=OE_3895F PE=3 SV=1 39 196 9.0E-23
sp|Q9HM46|TSR3_THEAC Probable ribosome biogenesis protein Ta0023 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0023 PE=3 SV=2 38 179 5.0E-22
sp|Q975W6|TSR3_SULTO Probable ribosome biogenesis protein STK_03110 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_03110 PE=3 SV=1 31 202 8.0E-22
sp|O26654|TSR3_METTH Probable ribosome biogenesis protein MTH_554 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_554 PE=3 SV=2 32 196 2.0E-21
sp|C3NEV4|TSR3_SULIY Probable ribosome biogenesis protein YG5714_1581 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_1581 PE=3 SV=1 31 179 5.0E-18
sp|C3NGU0|TSR3_SULIN Probable ribosome biogenesis protein YN1551_1255 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_1255 PE=3 SV=1 31 179 5.0E-18
sp|C3MWA4|TSR3_SULIM Probable ribosome biogenesis protein M1425_1577 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_1577 PE=3 SV=1 31 179 5.0E-18
sp|C3MQM6|TSR3_SULIL Probable ribosome biogenesis protein LS215_1685 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_1685 PE=3 SV=1 31 179 5.0E-18
sp|C4KHW1|TSR3_SULIK Probable ribosome biogenesis protein M164_1574 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_1574 PE=3 SV=1 31 179 5.0E-18
sp|C3N6E6|TSR3_SULIA Probable ribosome biogenesis protein M1627_1693 OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_1693 PE=3 SV=1 31 179 7.0E-18
sp|A5UJF3|TSR3_METS3 Probable ribosome biogenesis protein Msm_0126 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=Msm_0126 PE=3 SV=1 32 196 2.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4054
MPNTKSNKRRRRHGHSRGQSHPSSATAHAEFKAACWDLGHCDPKRCSGKRLMRLGLMRQLSLGQHHNGVIITPNG
KLLLSPADRQIMDQYGAAVVECSWARTHEVQWSKVGGGKMERLLPYLVAANTVNYGKPWRLNCAEALAAAFYICG
HADWAAQVLEPFAYGSAFLQINAAILDRYAACTDAADIKKTESEWMARLQCEYTKSREYNDDDIWMSGNTNRMPM
AMSDDDGDGDGNDNDDAQSHHSDTRDGIYLGKGPLGTRPTPSLPTLDHALPHYLASTDQDQEQDDDALMQDIRRR
VLASKSFSSPTSDFGSTSANRTRPTTIPRPQQRHQYRADLDIQPDLDHELVSNHSSVSHNSASDNDEEFDRIIEA
TPVTDKIGLAKLEKERRQATVTSRTYSSNFVSAPGRC*
Coding >OphauB2|4054
ATGCCCAACACCAAGTCCAACAAGCGCCGACGTCGCCATGGCCACAGCCGAGGCCAATCTCATCCGTCCTCAGCC
ACAGCCCATGCAGAATTCAAGGCAGCTTGCTGGGACTTGGGCCACTGCGATCCCAAGCGCTGCTCGGGCAAGCGC
CTGATGCGTCTGGGCCTCATGCGTCAACTGTCCCTGGGCCAGCACCACAACGGCGTAATCATAACCCCCAACGGC
AAGCTCCTTCTCTCTCCAGCCGACCGTCAAATCATGGACCAGTATGGCGCTGCCGTGGTTGAGTGCTCGTGGGCC
CGTACTCACGAGGTACAATGGTCCAAGGTTGGAGGCGGCAAGATGGAGCGTCTTCTGCCCTACCTCGTCGCTGCC
AACACGGTCAACTATGGCAAGCCTTGGCGTCTCAACTGTGCAGAGGCTCTGGCCGCAGCCTTTTACATTTGCGGC
CATGCTGATTGGGCTGCCCAGGTCCTGGAGCCCTTTGCATATGGGTCTGCGTTTCTGCAAATCAATGCTGCTATT
CTTGACCGATATGCTGCCTGCACAGATGCAGCTGACATCAAGAAGACGGAATCTGAGTGGATGGCAAGACTCCAA
TGCGAATATACCAAGAGCAGAGAGTACAACGACGATGACATATGGATGAGCGGTAACACGAATCGGATGCCCATG
GCAATGTCTGATGACGATGGCGATGGCGATGGCAATGACAATGACGATGCCCAATCTCACCACTCCGACACGCGG
GACGGCATTTACTTGGGTAAAGGTCCGCTCGGTACTAGACCAACCCCATCCCTTCCAACCCTGGACCACGCTCTG
CCTCACTACCTCGCCAGTACCGACCAAGACCAAGAACAAGACGACGACGCCCTCATGCAAGATATTCGTCGGCGC
GTTCTCGCATCCAAATCATTTTCAAGCCCCACCTCCGACTTTGGCTCTACTTCGGCCAATAGGACAAGGCCTACT
ACGATTCCCCGTCCCCAACAGCGGCATCAGTACAGGGCAGACTTGGACATACAGCCAGACCTGGACCATGAGCTT
GTGTCCAACCATAGTTCAGTCTCTCATAATAGCGCATCCGACAATGATGAAGAATTCGACCGAATCATAGAGGCC
ACCCCGGTTACGGATAAGATTGGACTTGCCAAGCTGGAAAAGGAAAGGCGCCAGGCTACAGTGACAAGCCGAACA
TATTCATCCAATTTCGTTTCTGCGCCAGGAAGATGCTAG
Transcript >OphauB2|4054
ATGCCCAACACCAAGTCCAACAAGCGCCGACGTCGCCATGGCCACAGCCGAGGCCAATCTCATCCGTCCTCAGCC
ACAGCCCATGCAGAATTCAAGGCAGCTTGCTGGGACTTGGGCCACTGCGATCCCAAGCGCTGCTCGGGCAAGCGC
CTGATGCGTCTGGGCCTCATGCGTCAACTGTCCCTGGGCCAGCACCACAACGGCGTAATCATAACCCCCAACGGC
AAGCTCCTTCTCTCTCCAGCCGACCGTCAAATCATGGACCAGTATGGCGCTGCCGTGGTTGAGTGCTCGTGGGCC
CGTACTCACGAGGTACAATGGTCCAAGGTTGGAGGCGGCAAGATGGAGCGTCTTCTGCCCTACCTCGTCGCTGCC
AACACGGTCAACTATGGCAAGCCTTGGCGTCTCAACTGTGCAGAGGCTCTGGCCGCAGCCTTTTACATTTGCGGC
CATGCTGATTGGGCTGCCCAGGTCCTGGAGCCCTTTGCATATGGGTCTGCGTTTCTGCAAATCAATGCTGCTATT
CTTGACCGATATGCTGCCTGCACAGATGCAGCTGACATCAAGAAGACGGAATCTGAGTGGATGGCAAGACTCCAA
TGCGAATATACCAAGAGCAGAGAGTACAACGACGATGACATATGGATGAGCGGTAACACGAATCGGATGCCCATG
GCAATGTCTGATGACGATGGCGATGGCGATGGCAATGACAATGACGATGCCCAATCTCACCACTCCGACACGCGG
GACGGCATTTACTTGGGTAAAGGTCCGCTCGGTACTAGACCAACCCCATCCCTTCCAACCCTGGACCACGCTCTG
CCTCACTACCTCGCCAGTACCGACCAAGACCAAGAACAAGACGACGACGCCCTCATGCAAGATATTCGTCGGCGC
GTTCTCGCATCCAAATCATTTTCAAGCCCCACCTCCGACTTTGGCTCTACTTCGGCCAATAGGACAAGGCCTACT
ACGATTCCCCGTCCCCAACAGCGGCATCAGTACAGGGCAGACTTGGACATACAGCCAGACCTGGACCATGAGCTT
GTGTCCAACCATAGTTCAGTCTCTCATAATAGCGCATCCGACAATGATGAAGAATTCGACCGAATCATAGAGGCC
ACCCCGGTTACGGATAAGATTGGACTTGCCAAGCTGGAAAAGGAAAGGCGCCAGGCTACAGTGACAAGCCGAACA
TATTCATCCAATTTCGTTTCTGCGCCAGGAAGATGCTAG
Gene >OphauB2|4054
ATGCCCAACACCAAGTCCAACAAGCGCCGACGTCGCCATGGCCACAGCCGAGGCCAATCTCATCCGTCCTCAGCC
ACAGCCCATGCAGAATTCAAGGCAGCTTGCTGGGACTTGGGCCACTGCGATCCCAAGCGCTGCTCGGGCAAGCGC
CTGATGCGTCTGGGCCTCATGCGTCAACTGTCCCTGGGCCAGCACCACAACGGCGTAATCATAACCCCCAACGGC
AAGCTCCTTCTCTCTCCAGCCGACCGTCAAATCATGGACCAGTATGGCGCTGCCGTGGTTGAGTGCTCGTGGGCC
CGTACTCACGAGGTACAATGGTCCAAGGTTGGAGGCGGCAAGATGGAGCGTCTTCTGCCCTACCTCGTCGCTGCC
AACACGGTCAACTATGGCAAGCCTTGGCGTCTCAACTGTGCAGAGGCTCTGGCCGCAGCCTTTTACATTTGCGGC
CATGCTGATTGGGCTGCCCAGGTCCTGGAGCCCTTTGCATATGGGTCTGCGTTTCTGCAAATCAATGCTGCTATT
CTTGACCGATATGCTGCCTGCACAGATGCAGCTGACATCAAGAAGACGGAATCTGAGTGGATGGCAAGACTCCAA
TGCGAATATACCAAGAGCAGAGAGTACAACGACGATGACATATGGATGAGCGGTAACACGAATCGGATGCCCATG
GCAATGTCTGATGACGATGGCGATGGCGATGGCAATGACAATGACGATGCCCAATCTCACCACTCCGACACGCGG
GACGGCATTTACTTGGGTAAAGGTCCGCTCGGTACTAGACCAACCCCATCCCTTCCAACCCTGGACCACGCTCTG
CCTCACTACCTCGCCAGTACCGACCAAGACCAAGAACAAGACGACGACGCCCTCATGCAAGATATTCGTCGGCGC
GTTCTCGCATCCAAATCATTTTCAAGCCCCACCTCCGACTTTGGCTCTACTTCGGCCAATAGGACAAGGCCTACT
ACGATTCCCCGTCCCCAACAGCGGCATCAGTACAGGGCAGACTTGGACATACAGCCAGACCTGGACCATGAGCTT
GTGTCCAACCATAGTTCAGTCTCTCATAATAGCGCATCCGACAATGATGAAGAATTCGACCGAATCATAGAGGCC
ACCCCGGTTACGGATAAGATTGGACTTGCCAAGCTGGAAAAGGAAAGGCGCCAGGCTACAGTGACAAGCCGAACA
TATTCATCCAATTTCGTTTCTGCGCCAGGAAGATGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail