Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4053
Gene name
LocationContig_261:6437..8486
Strand-
Gene length (bp)2049
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 3.5E-42 24 165
PF03127 GAT GAT domain 1.6E-19 248 323
PF02883 Alpha_adaptinC2 Adaptin C-terminal domain 1.1E-17 502 611
PF18308 GGA_N-GAT N-terminal extension of GAT domain 8.0E-07 196 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87157|YB0G_SCHPO Probable ADP-ribosylation factor-binding protein C25H2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.16c PE=1 SV=1 25 596 3.0E-115
sp|P38817|GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA2 PE=1 SV=1 19 606 2.0E-114
sp|Q06336|GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA1 PE=1 SV=1 24 594 9.0E-101
sp|Q10410|YD85_SCHPO Probable ADP-ribosylation factor-binding protein C1F3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F3.05 PE=3 SV=1 26 353 4.0E-82
sp|Q8R0H9|GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus GN=Gga1 PE=1 SV=1 26 412 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87157|YB0G_SCHPO Probable ADP-ribosylation factor-binding protein C25H2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.16c PE=1 SV=1 25 596 3.0E-115
sp|P38817|GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA2 PE=1 SV=1 19 606 2.0E-114
sp|Q06336|GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA1 PE=1 SV=1 24 594 9.0E-101
sp|Q10410|YD85_SCHPO Probable ADP-ribosylation factor-binding protein C1F3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F3.05 PE=3 SV=1 26 353 4.0E-82
sp|Q8R0H9|GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus GN=Gga1 PE=1 SV=1 26 412 2.0E-22
sp|Q6P5E6|GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus GN=Gga2 PE=1 SV=1 26 611 4.0E-21
sp|Q9UJY4|GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens GN=GGA2 PE=1 SV=3 22 611 2.0E-20
sp|Q9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens GN=GGA1 PE=1 SV=1 26 405 2.0E-19
sp|Q68FJ8|TM1L2_XENLA TOM1-like protein 2 OS=Xenopus laevis GN=tom1l2 PE=2 SV=1 44 391 9.0E-17
sp|Q2GS33|VPS27_CHAGB Vacuolar protein sorting-associated protein 27 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS27 PE=3 SV=2 42 169 5.0E-16
sp|A2QWA2|VPS27_ASPNC Vacuolar protein sorting-associated protein 27 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=vps27 PE=3 SV=1 42 169 3.0E-15
sp|Q8BMI3|GGA3_MOUSE ADP-ribosylation factor-binding protein GGA3 OS=Mus musculus GN=Gga3 PE=1 SV=2 26 376 3.0E-15
sp|Q4WHN8|VPS27_ASPFU Vacuolar protein sorting-associated protein 27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vps27 PE=3 SV=1 42 169 4.0E-15
sp|A1DFP5|VPS27_NEOFI Vacuolar protein sorting-associated protein 27 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vps27 PE=3 SV=1 42 169 5.0E-15
sp|Q9NZ52|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens GN=GGA3 PE=1 SV=1 26 376 7.0E-15
sp|Q7RZJ2|VPS27_NEUCR Vacuolar protein sorting-associated protein 27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vps27 PE=3 SV=2 42 169 7.0E-15
sp|A4QTV1|VPS27_MAGO7 Vacuolar protein sorting-associated protein 27 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS27 PE=3 SV=1 42 169 8.0E-15
sp|Q0CJV3|VPS27_ASPTN Vacuolar protein sorting-associated protein 27 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps27 PE=3 SV=1 16 169 2.0E-14
sp|A1CEK1|VPS27_ASPCL Vacuolar protein sorting-associated protein 27 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vps27 PE=3 SV=1 16 169 2.0E-14
sp|Q6ZVM7|TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens GN=TOM1L2 PE=1 SV=1 44 391 4.0E-14
sp|Q5SRX1|TM1L2_MOUSE TOM1-like protein 2 OS=Mus musculus GN=Tom1l2 PE=1 SV=1 44 391 7.0E-14
sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 42 169 8.0E-14
sp|Q5BBK9|VPS27_EMENI Vacuolar protein sorting-associated protein 27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vps27 PE=3 SV=1 16 169 2.0E-13
sp|Q6CFT4|VPS27_YARLI Vacuolar protein sorting-associated protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VPS27 PE=3 SV=1 40 178 2.0E-12
sp|O88746|TOM1_MOUSE Target of Myb protein 1 OS=Mus musculus GN=Tom1 PE=1 SV=1 44 393 3.0E-12
sp|Q960X8|HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster GN=Hrs PE=1 SV=1 40 176 4.0E-12
sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 19 176 4.0E-12
sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 19 176 4.0E-12
sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 19 176 5.0E-12
sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 19 176 9.0E-12
sp|O60784|TOM1_HUMAN Target of Myb protein 1 OS=Homo sapiens GN=TOM1 PE=1 SV=2 44 169 4.0E-11
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 42 170 7.0E-11
sp|O13821|VPS27_SCHPO Vacuolar protein sorting-associated protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst4 PE=3 SV=1 43 170 9.0E-11
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 42 170 9.0E-11
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 30 235 4.0E-10
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 30 235 5.0E-10
sp|O12940|TOM1_CHICK Target of Myb protein 1 OS=Gallus gallus GN=TOM1 PE=2 SV=2 44 169 6.0E-10
sp|Q4P7Q1|VPS27_USTMA Vacuolar protein sorting-associated protein 27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS27 PE=3 SV=1 42 137 7.0E-10
sp|Q6BSD6|VPS27_DEBHA Vacuolar protein sorting-associated protein 27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VPS27 PE=3 SV=2 22 170 1.0E-09
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2 22 168 2.0E-09
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 29 212 3.0E-09
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 26 137 8.0E-09
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 26 203 9.0E-09
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 26 169 1.0E-08
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 47 196 1.0E-08
sp|O75886|STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens GN=STAM2 PE=1 SV=1 26 203 2.0E-08
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 42 161 4.0E-08
sp|P0CS26|VPS27_CRYNJ Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VPS27 PE=3 SV=1 16 168 6.0E-08
sp|P0CS27|VPS27_CRYNB Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VPS27 PE=3 SV=1 16 168 6.0E-08
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 42 154 7.0E-08
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 42 161 8.0E-08
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 29 160 1.0E-07
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 22 110 1.0E-07
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 42 196 2.0E-07
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 42 161 2.0E-07
sp|A3LX75|VPS27_PICST Vacuolar protein sorting-associated protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VPS27 PE=3 SV=2 38 170 2.0E-07
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 42 201 5.0E-07
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 42 161 1.0E-06
sp|O75674|TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens GN=TOM1L1 PE=1 SV=2 47 169 2.0E-06
sp|Q923U0|TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus GN=Tom1l1 PE=1 SV=1 47 169 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0043130 ubiquitin binding Yes
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0071702 organic substance transport No
GO:0005543 phospholipid binding No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0008289 lipid binding No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0032182 ubiquitin-like protein binding No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4053
MEAASARAAAAARDRWSDVGRPLSQLQRFVAAACSPENDEPNLAMNLEVCDLINSKKGSAPREAATAIVGCINHR
NPTVALLALQLLDNCVKNCGYPFQLQISTKEFLNELVRRFPERPPLHQTRVQAKILEAIEEWRVTICETSRYRED
FGFIRDMHRLLSYKGYMFPEVRREDAAVLNPSDNLKSADEMEEEEKEAQSAKLQELIRRGSPEDLREANRLMKIM
AGYDNRSKTDYRAKAAEEIGKIQAKARLLEERLGAFKPGDKMTEGDVFSELATALQSAQPKIQKMCEEESDDHEA
VAKLLEINDSIHRTVERYKLMNKGDMQGAAKIAAGAPPSSQAASATELSLIDFDAEGPDANGSSSSPANKSQADG
LENDLLGLDMGGQSATFGQGGNIALGFGANQNVPGPALLSSLTQGNKTSSLAQYASLSSPAPSQPSTPQPHPPPM
PQPAVNMLAALSAGAAPSRPAVANDEEEWSFTSSLPAETQTKPSEHKAIVCDKDLRIDLLAQRLPGTKSIKVFFF
FTNTTTQPISELHFQLAVTKGYELELRPQSGRNLAPKQNRGVTQEMDVWHAGNRWQRVESAKLRWRAAYKVANVE
QRSETGEIAEFEVA*
Coding >OphauB2|4053
ATGGAGGCTGCTTCCGCCCGCGCCGCTGCCGCCGCCCGCGACCGATGGAGCGACGTTGGCCGGCCTCTCTCACAG
CTGCAGCGCTTTGTCGCTGCCGCATGCAGCCCGGAAAACGACGAGCCCAATCTAGCAATGAATCTCGAGGTATGC
GACCTCATCAACAGCAAAAAGGGCAGTGCGCCTCGCGAGGCTGCCACGGCCATTGTCGGCTGCATCAACCACCGT
AACCCAACTGTCGCGCTTCTCGCCCTGCAGCTGCTCGACAACTGTGTCAAGAACTGCGGCTACCCTTTCCAACTT
CAAATCAGCACCAAGGAGTTCCTCAATGAGCTGGTGCGCAGATTTCCCGAGCGCCCTCCCCTCCACCAGACGCGC
GTGCAGGCAAAGATTCTCGAAGCCATAGAGGAGTGGCGTGTGACGATATGCGAGACGAGCAGATACAGAGAAGAC
TTTGGCTTTATTAGAGATATGCATCGTCTCTTGAGCTACAAAGGCTACATGTTTCCCGAGGTCCGCCGAGAGGAT
GCTGCTGTGCTAAACCCCAGCGATAACCTCAAGTCAGCTGATGAGATGGAAGAGGAGGAAAAGGAGGCCCAGTCG
GCCAAGTTGCAGGAGCTCATCCGTAGAGGTTCTCCCGAGGATCTGCGCGAAGCAAATCGCCTCATGAAGATCATG
GCCGGCTACGACAACCGTTCCAAAACGGACTATCGTGCCAAAGCGGCCGAGGAGATTGGCAAGATTCAGGCCAAG
GCACGACTCCTTGAAGAACGTCTTGGTGCTTTCAAGCCCGGAGACAAGATGACCGAGGGCGACGTCTTCAGCGAA
CTGGCCACGGCTCTGCAGAGCGCCCAGCCCAAGATTCAAAAAATGTGTGAGGAGGAGTCGGACGACCACGAGGCT
GTGGCCAAGCTGCTTGAAATCAACGACAGCATACATCGCACCGTCGAGCGCTATAAGCTGATGAACAAGGGAGAC
ATGCAAGGCGCAGCCAAGATAGCGGCAGGCGCGCCGCCATCGTCGCAGGCCGCGTCAGCCACGGAGCTGTCATTG
ATAGATTTTGACGCCGAGGGGCCTGATGCCAATGGCTCCTCCTCCTCACCTGCCAACAAGTCGCAGGCCGACGGA
CTCGAGAATGATCTTCTCGGCCTTGACATGGGCGGCCAGTCGGCTACTTTTGGCCAAGGCGGCAACATTGCCCTT
GGCTTTGGCGCCAATCAGAACGTCCCCGGCCCGGCTCTTCTTTCATCCCTCACCCAGGGCAACAAGACGTCTTCC
CTCGCTCAATATGCATCCCTCTCGTCCCCAGCTCCTTCGCAGCCAAGCACACCGCAGCCTCACCCTCCTCCCATG
CCACAGCCGGCCGTCAACATGCTTGCCGCCCTGAGCGCTGGCGCAGCCCCATCAAGGCCCGCAGTAGCAAATGAC
GAGGAGGAATGGAGCTTTACCTCGTCACTCCCGGCAGAGACTCAAACAAAGCCCTCGGAACACAAGGCAATCGTG
TGTGACAAGGATCTTAGAATTGACCTCTTGGCCCAGCGTCTCCCTGGCACCAAGTCGATCAAAGTCTTCTTCTTC
TTCACCAACACCACCACCCAACCCATCTCTGAGCTTCACTTCCAGCTCGCCGTCACAAAGGGCTACGAGCTCGAG
CTCAGACCTCAGTCAGGACGCAATCTTGCTCCAAAACAGAACCGAGGCGTGACGCAAGAGATGGACGTTTGGCAT
GCCGGAAATCGTTGGCAGAGAGTAGAGTCGGCCAAGCTGCGGTGGCGCGCCGCCTACAAAGTTGCTAATGTTGAG
CAGCGAAGCGAGACGGGTGAGATTGCTGAATTCGAGGTGGCGTGA
Transcript >OphauB2|4053
ATGGAGGCTGCTTCCGCCCGCGCCGCTGCCGCCGCCCGCGACCGATGGAGCGACGTTGGCCGGCCTCTCTCACAG
CTGCAGCGCTTTGTCGCTGCCGCATGCAGCCCGGAAAACGACGAGCCCAATCTAGCAATGAATCTCGAGGTATGC
GACCTCATCAACAGCAAAAAGGGCAGTGCGCCTCGCGAGGCTGCCACGGCCATTGTCGGCTGCATCAACCACCGT
AACCCAACTGTCGCGCTTCTCGCCCTGCAGCTGCTCGACAACTGTGTCAAGAACTGCGGCTACCCTTTCCAACTT
CAAATCAGCACCAAGGAGTTCCTCAATGAGCTGGTGCGCAGATTTCCCGAGCGCCCTCCCCTCCACCAGACGCGC
GTGCAGGCAAAGATTCTCGAAGCCATAGAGGAGTGGCGTGTGACGATATGCGAGACGAGCAGATACAGAGAAGAC
TTTGGCTTTATTAGAGATATGCATCGTCTCTTGAGCTACAAAGGCTACATGTTTCCCGAGGTCCGCCGAGAGGAT
GCTGCTGTGCTAAACCCCAGCGATAACCTCAAGTCAGCTGATGAGATGGAAGAGGAGGAAAAGGAGGCCCAGTCG
GCCAAGTTGCAGGAGCTCATCCGTAGAGGTTCTCCCGAGGATCTGCGCGAAGCAAATCGCCTCATGAAGATCATG
GCCGGCTACGACAACCGTTCCAAAACGGACTATCGTGCCAAAGCGGCCGAGGAGATTGGCAAGATTCAGGCCAAG
GCACGACTCCTTGAAGAACGTCTTGGTGCTTTCAAGCCCGGAGACAAGATGACCGAGGGCGACGTCTTCAGCGAA
CTGGCCACGGCTCTGCAGAGCGCCCAGCCCAAGATTCAAAAAATGTGTGAGGAGGAGTCGGACGACCACGAGGCT
GTGGCCAAGCTGCTTGAAATCAACGACAGCATACATCGCACCGTCGAGCGCTATAAGCTGATGAACAAGGGAGAC
ATGCAAGGCGCAGCCAAGATAGCGGCAGGCGCGCCGCCATCGTCGCAGGCCGCGTCAGCCACGGAGCTGTCATTG
ATAGATTTTGACGCCGAGGGGCCTGATGCCAATGGCTCCTCCTCCTCACCTGCCAACAAGTCGCAGGCCGACGGA
CTCGAGAATGATCTTCTCGGCCTTGACATGGGCGGCCAGTCGGCTACTTTTGGCCAAGGCGGCAACATTGCCCTT
GGCTTTGGCGCCAATCAGAACGTCCCCGGCCCGGCTCTTCTTTCATCCCTCACCCAGGGCAACAAGACGTCTTCC
CTCGCTCAATATGCATCCCTCTCGTCCCCAGCTCCTTCGCAGCCAAGCACACCGCAGCCTCACCCTCCTCCCATG
CCACAGCCGGCCGTCAACATGCTTGCCGCCCTGAGCGCTGGCGCAGCCCCATCAAGGCCCGCAGTAGCAAATGAC
GAGGAGGAATGGAGCTTTACCTCGTCACTCCCGGCAGAGACTCAAACAAAGCCCTCGGAACACAAGGCAATCGTG
TGTGACAAGGATCTTAGAATTGACCTCTTGGCCCAGCGTCTCCCTGGCACCAAGTCGATCAAAGTCTTCTTCTTC
TTCACCAACACCACCACCCAACCCATCTCTGAGCTTCACTTCCAGCTCGCCGTCACAAAGGGCTACGAGCTCGAG
CTCAGACCTCAGTCAGGACGCAATCTTGCTCCAAAACAGAACCGAGGCGTGACGCAAGAGATGGACGTTTGGCAT
GCCGGAAATCGTTGGCAGAGAGTAGAGTCGGCCAAGCTGCGGTGGCGCGCCGCCTACAAAGTTGCTAATGTTGAG
CAGCGAAGCGAGACGGGTGAGATTGCTGAATTCGAGGTGGCGTGA
Gene >OphauB2|4053
ATGGAGGCTGCTTCCGCCCGCGCCGCTGCCGCCGCCCGCGACCGATGGAGCGACGTTGGCCGGCCTCTCTCACAG
CTGCAGCGCTTTGTCGCTGCCGCATGCAGCCCGGAAAACGACGAGCCCAATCTAGCAATGAATCTCGAGGTATGC
GACCTCATCAACAGCAAAAAGGGCAGTGCGCCTCGCGAGGCTGCCACGGCCATTGTCGGCTGCATCAACCACCGT
AACCCAACTGTCGCGCTTCTCGCCCTGCAGCTGCTCGACAACTGTGTCAAGAACTGCGGCTACCCTTTCCAACTT
CAAATCAGCACCAAGGAGTTCCTCAATGAGCTGGTGCGCAGATTTCCCGAGCGCCCTCCCCTCCACCAGACGCGC
GTGCAGGCAAAGATTCTCGAAGCCATAGAGGAGTGGCGTGTGACGATATGCGAGACGAGCAGATACAGAGAAGAC
TTTGGCTTTATTAGAGATATGCATCGTCTCTTGAGCTACAAAGGCTACATGTTTCCCGAGGTCCGCCGAGAGGAT
GCTGCTGTGCTAAACCCCAGCGATGTGAGTGTGGCTGGTTGCCTCGGTGCCTGCTGTCTCGTTGCTAAATCTCTT
GTCCTCTAGAACCTCAAGTCAGCTGATGAGATGGAAGAGGAGGAAAAGGAGGCCCAGTCGGCCAAGTTGCAGGAG
CTCATCCGTAGAGGTTCTCCCGAGGATCTGCGCGAAGCAAATCGCCTCATGAAGATCATGGCCGGCTACGACAAC
CGTTCCAAAACGGACTATCGTGCCAAAGCGGCCGAGGAGATTGGCAAGATTCAGGCCAAGGCACGACTCCTTGAA
GAACGTCTTGGTGCTTTCAAGCCCGGAGACAAGATGACCGAGGGCGACGTCTTCAGCGAACTGGCCACGGCTCTG
CAGAGCGCCCAGCCCAAGATTCAAAAAATGTGTGAGGAGGAGTCGGACGACCACGAGGCTGTGGCCAAGCTGCTT
GAAATCAACGACAGCATACATCGCACCGTCGAGCGCTATAAGCTGATGAACAAGGGAGACATGCAAGGCGCAGCC
AAGATAGCGGCAGGCGCGCCGCCATCGTCGCAGGCCGCGTCAGCCACGGAGCTGTCATTGATAGATTTTGACGCC
GAGGGGCCTGATGCCAATGGCTCCTCCTCCTCACCTGCCAACAAGTCGCAGGCCGACGGACTCGAGAATGATCTT
CTCGGCCTTGACATGGGCGGCCAGTCGGCTACTTTTGGCCAAGGCGGCAACATTGCCCTTGGCTTTGGCGCCAAT
CAGAGTCGGTCTCTGCACTTGCAGTCACTGCTGTTTGCCCTGCTAACCCGAGACTCATCTAGACGTCCCCGGCCC
GGCTCTTCTTTCATCCCTCACCCAGGGCAACAAGACGTCTTCCCTCGCTCAATATGCATCCCTCTCGTCCCCAGC
TCCTTCGCAGCCAAGCACACCGCAGCCTCACCCTCCTCCCATGCCACAGCCGGCCGTCAACATGCTTGCCGCCCT
GAGCGCTGGCGCAGCCCCATCAAGGCCCGCAGTAGCAAATGACGAGGAGGAATGGAGCTTTACCTCGTCACTCCC
GGCAGAGACTCAAACAAAGCCCTCGGAACACAAGGCAATCGTGTGTGACAAGGATCTTAGAATTGACCTCTTGGC
CCAGCGTCTCCCTGGCACCAAGTCGATCAAAGTCTTCTTCTTCTTCACCAACACCACCACCCAACCCATCTCTGA
GCTTCACTTCCAGCTCGCCGTCACAAAGGTTAGCCATGCCTCGCCTAACCACTCCCTGTCCCCCCCCACACGCCC
ACTGCACAATTTCCATTGGTAATCTAACACGGTATAAAGGGCTACGAGCTCGAGCTCAGACCTCAGTCAGGACGC
AATCTTGCTCCAAAACAGAACCGAGGCGTGACGCAAGAGATGGACGTTTGGCATGCCGGAAATCGTTGGCAGAGA
GTAGAGTCGGCCAAGCTGCGGTGGCGCGCCGCCTACAAAGTTGCTAATGTTGAGCAGCGAAGCGAGACGGGTGAG
ATTGCTGAATTCGAGGTGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail