Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4050
Gene name
LocationContig_260:11505..14617
Strand+
Gene length (bp)3112
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20470 HTH_61 Helix-turn-helix domain 1.5E-25 570 659
PF00270 DEAD DEAD/DEAH box helicase 1.4E-14 153 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 91 867 3.0E-119
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 119 867 2.0E-114
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 119 867 6.0E-114
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 99 867 2.0E-110
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 121 859 1.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 91 867 3.0E-119
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 119 867 2.0E-114
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 119 867 6.0E-114
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 99 867 2.0E-110
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 121 859 1.0E-84
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 25 859 2.0E-81
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 126 867 2.0E-75
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 135 862 4.0E-41
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 135 862 3.0E-39
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 123 697 7.0E-39
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 123 697 1.0E-38
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 119 697 3.0E-38
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 135 862 2.0E-37
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 135 867 2.0E-37
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 122 857 6.0E-37
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 122 715 1.0E-36
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 123 633 2.0E-36
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 123 633 2.0E-36
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 123 684 2.0E-36
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 122 715 3.0E-36
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 123 719 4.0E-36
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 138 692 1.0E-35
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 123 652 1.0E-35
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 135 867 3.0E-35
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 135 867 5.0E-35
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 123 684 3.0E-34
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 122 867 6.0E-34
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 135 684 2.0E-32
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 138 860 5.0E-32
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 123 684 2.0E-30
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 123 644 2.0E-30
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 135 862 3.0E-30
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 134 640 7.0E-30
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 10 600 1.0E-24
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 153 600 6.0E-24
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 130 600 7.0E-24
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 150 634 1.0E-23
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 153 600 5.0E-22
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 154 601 8.0E-22
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 153 600 3.0E-21
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 153 600 4.0E-21
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 153 600 5.0E-21
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 152 618 7.0E-21
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 153 600 3.0E-20
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 123 600 2.0E-19
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 152 619 3.0E-19
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 103 564 8.0E-19
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 152 666 2.0E-17
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 135 526 3.0E-17
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 134 352 8.0E-17
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 152 666 1.0E-16
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 136 638 3.0E-16
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 152 599 3.0E-16
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 152 599 3.0E-16
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 123 371 1.0E-15
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 152 564 1.0E-15
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 155 674 2.0E-15
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 155 674 4.0E-15
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 155 674 5.0E-15
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 152 601 3.0E-14
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 156 610 5.0E-14
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 150 593 2.0E-12
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 153 565 3.0E-09
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 153 565 3.0E-09
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 527 862 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4050
MKSMQGIWHRTSLQEAQQRVQQDAQQDAQQDAQQDAQQDAQQNAQAQGQPNGRLRSIATTHSGIEFQRAINIPAV
ASRLEASNIVDLGQPPVVSEYSQRRHLAATPSSSWDAELGLAHAAYKLPPQLVANFAALGITQMYPWQKNCLKGP
GLLKGDKNLVYSAPTGGGKSLVADLLMLKRVIESPGTKALVVLPYVALVQEKVGWLRRVVRQLPSPADAPQAHLD
RPGPWRRRADQDTLRVVGFFGGGKVRAAWDDFEIAVCTLEKANALINTAIDDCSIAPLRAVVLDELHMIDDDHRG
YLLELIGTKLLSLEQPLQIIGMSATLPNMDLVAAWLNAHCYETHYRPVPIEEHLVYDSNVFAVASVQPWQQKLGQ
TTSLSTPVRQIQTSAHREFTDPVLNAVVALAYETASSGFGALIFASSRSLCESDARCISRVMPEPRDISSSLRDK
RLNLLGDLRSLSSGVDPVLEETVLYGVAFHRECLACGYAMALGPRLTRSIQIEERELIAAAYDAGTILVCVATCS
LAAGINLPARRVILHNARMGRDLVGPSMLRQMRGRAGRPGRCPVGETYLCCRQSDLDQVLELMQAEMPAISSCLS
TDNRRVQRALLEAISTRLASSQESINDYFAKSLLRHSHGGQFVKECTQSSLDEVERMGLATCDSLGHWTPTQLGK
AIVASSIDPDDGVFVHRELTKALRAFAMDGEMHILYIFTPVQDFGVSVNWQVFRNEMEALDDNGLRVLSFVGIKP
TALLRLAQGGSLKETTQEEKDQARVYRRFYLALQLRDLCNEMPIHVVSRKYDMPRGAVQTLSQTCQGFAAGMVKF
CEHMGWGVMAAALDHFTDRLMAGARADLLALTKIPFIKSRTA*
Coding >OphauB2|4050
ATGAAGAGCATGCAGGGCATCTGGCACAGAACCAGTCTGCAGGAAGCCCAGCAAAGAGTCCAGCAAGATGCCCAG
CAAGATGCCCAGCAAGACGCCCAGCAAGACGCCCAGCAAGACGCCCAGCAAAACGCCCAGGCACAAGGCCAGCCC
AATGGCCGGCTACGAAGCATAGCCACAACACACAGCGGCATCGAGTTCCAGCGCGCAATCAACATCCCTGCTGTC
GCGAGCCGCCTCGAAGCCAGCAACATTGTAGACTTGGGCCAGCCTCCAGTAGTCTCCGAGTACTCGCAGCGGCGC
CATCTTGCGGCCACGCCGTCGTCGTCATGGGATGCAGAGCTCGGTCTTGCTCATGCCGCATATAAGCTCCCGCCT
CAGCTCGTGGCCAACTTTGCCGCCCTGGGCATCACCCAAATGTATCCTTGGCAAAAGAATTGTCTCAAGGGGCCT
GGCCTTCTCAAAGGAGACAAGAACCTCGTCTACTCTGCCCCGACGGGCGGTGGCAAATCCTTGGTCGCTGATTTG
CTCATGTTGAAACGCGTCATTGAGAGTCCAGGCACCAAGGCTCTTGTTGTGCTCCCCTACGTCGCTCTTGTTCAG
GAAAAGGTTGGCTGGCTTCGACGTGTTGTCCGCCAACTACCAAGTCCAGCCGATGCGCCCCAAGCCCATCTAGAC
AGGCCGGGACCTTGGCGACGACGTGCAGACCAAGACACCCTGCGAGTCGTCGGTTTCTTTGGTGGCGGCAAAGTC
AGAGCCGCCTGGGATGATTTTGAAATTGCTGTCTGCACTCTGGAAAAGGCCAATGCACTTATTAATACGGCCATT
GACGATTGCTCCATCGCACCGCTCCGAGCTGTTGTGCTGGACGAGTTGCACATGATTGACGACGACCATCGCGGC
TATCTGCTCGAGCTCATAGGCACCAAGCTGCTGAGTCTAGAGCAGCCACTTCAAATCATAGGCATGAGCGCCACA
CTCCCGAACATGGATTTGGTGGCGGCGTGGCTTAATGCACACTGCTATGAAACACACTATCGGCCAGTGCCCATC
GAGGAACACCTTGTGTATGACAGTAATGTCTTTGCAGTCGCATCTGTTCAGCCATGGCAGCAAAAGCTTGGGCAG
ACGACGAGTCTGTCGACTCCAGTTAGGCAGATCCAAACCTCGGCTCACAGGGAGTTTACCGATCCCGTTCTCAAT
GCCGTTGTGGCGCTAGCCTACGAGACTGCCTCTTCTGGATTTGGCGCCTTGATATTCGCTAGCAGCCGAAGCCTC
TGCGAGTCGGACGCCCGCTGCATCAGTCGAGTAATGCCCGAGCCTCGTGACATTAGTAGCAGCCTGAGAGATAAA
AGGCTGAACCTGCTTGGCGACTTGCGAAGCTTGAGCTCTGGCGTTGACCCAGTGCTAGAAGAGACGGTCTTGTAC
GGCGTGGCATTTCATCGTGAGTGCCTTGCCTGCGGCTATGCCATGGCACTTGGGCCGAGGCTGACGCGAAGTATA
CAGATCGAGGAGCGTGAGCTGATTGCTGCCGCATACGATGCCGGGACAATTCTTGTCTGCGTGGCAACGTGCAGC
CTCGCCGCTGGCATCAACCTCCCGGCGCGCAGAGTCATATTGCACAACGCTCGCATGGGTCGCGATTTGGTTGGC
CCGTCCATGCTCAGGCAGATGAGAGGTCGGGCTGGACGGCCGGGCAGATGTCCTGTTGGCGAGACATATCTCTGT
TGCCGACAAAGCGACTTGGATCAGGTCCTGGAGCTTATGCAGGCCGAGATGCCAGCAATCTCAAGCTGCTTGAGC
ACTGACAACAGACGGGTTCAACGCGCGCTCTTGGAAGCCATTTCAACCCGTCTGGCAAGCAGCCAAGAATCCATC
AACGACTACTTTGCCAAGTCATTGCTCAGGCATTCACATGGCGGACAATTTGTCAAGGAGTGCACCCAGTCAAGC
CTAGACGAGGTGGAGCGAATGGGCCTGGCGACGTGCGATAGCTTGGGCCACTGGACTCCAACGCAGCTGGGCAAA
GCAATAGTTGCATCGTCTATCGACCCCGACGACGGCGTCTTTGTCCACCGAGAGCTGACCAAGGCGCTGCGGGCG
TTTGCAATGGATGGCGAGATGCACATTTTGTACATCTTCACTCCTGTCCAGGACTTTGGCGTCTCGGTCAACTGG
CAGGTGTTCCGCAACGAGATGGAAGCGCTGGATGACAATGGGCTGCGCGTGCTGAGCTTTGTCGGCATCAAGCCG
ACGGCGCTTCTTCGATTGGCTCAGGGGGGCTCCCTCAAAGAGACAACGCAAGAGGAAAAGGATCAGGCGCGGGTA
TATCGCCGCTTTTACCTGGCGCTTCAGCTTCGCGACCTGTGCAACGAGATGCCAATACACGTTGTTTCTCGCAAG
TACGATATGCCTCGAGGAGCCGTCCAGACTCTGTCGCAGACGTGTCAAGGCTTTGCCGCCGGCATGGTCAAGTTT
TGCGAGCACATGGGATGGGGAGTTATGGCGGCAGCACTAGATCATTTCACAGATCGGCTCATGGCAGGAGCCAGA
GCTGATCTCTTGGCTTTGACCAAGATTCCCTTTATCAAGAGCCGCACAGCGTAA
Transcript >OphauB2|4050
ATGAAGAGCATGCAGGGCATCTGGCACAGAACCAGTCTGCAGGAAGCCCAGCAAAGAGTCCAGCAAGATGCCCAG
CAAGATGCCCAGCAAGACGCCCAGCAAGACGCCCAGCAAGACGCCCAGCAAAACGCCCAGGCACAAGGCCAGCCC
AATGGCCGGCTACGAAGCATAGCCACAACACACAGCGGCATCGAGTTCCAGCGCGCAATCAACATCCCTGCTGTC
GCGAGCCGCCTCGAAGCCAGCAACATTGTAGACTTGGGCCAGCCTCCAGTAGTCTCCGAGTACTCGCAGCGGCGC
CATCTTGCGGCCACGCCGTCGTCGTCATGGGATGCAGAGCTCGGTCTTGCTCATGCCGCATATAAGCTCCCGCCT
CAGCTCGTGGCCAACTTTGCCGCCCTGGGCATCACCCAAATGTATCCTTGGCAAAAGAATTGTCTCAAGGGGCCT
GGCCTTCTCAAAGGAGACAAGAACCTCGTCTACTCTGCCCCGACGGGCGGTGGCAAATCCTTGGTCGCTGATTTG
CTCATGTTGAAACGCGTCATTGAGAGTCCAGGCACCAAGGCTCTTGTTGTGCTCCCCTACGTCGCTCTTGTTCAG
GAAAAGGTTGGCTGGCTTCGACGTGTTGTCCGCCAACTACCAAGTCCAGCCGATGCGCCCCAAGCCCATCTAGAC
AGGCCGGGACCTTGGCGACGACGTGCAGACCAAGACACCCTGCGAGTCGTCGGTTTCTTTGGTGGCGGCAAAGTC
AGAGCCGCCTGGGATGATTTTGAAATTGCTGTCTGCACTCTGGAAAAGGCCAATGCACTTATTAATACGGCCATT
GACGATTGCTCCATCGCACCGCTCCGAGCTGTTGTGCTGGACGAGTTGCACATGATTGACGACGACCATCGCGGC
TATCTGCTCGAGCTCATAGGCACCAAGCTGCTGAGTCTAGAGCAGCCACTTCAAATCATAGGCATGAGCGCCACA
CTCCCGAACATGGATTTGGTGGCGGCGTGGCTTAATGCACACTGCTATGAAACACACTATCGGCCAGTGCCCATC
GAGGAACACCTTGTGTATGACAGTAATGTCTTTGCAGTCGCATCTGTTCAGCCATGGCAGCAAAAGCTTGGGCAG
ACGACGAGTCTGTCGACTCCAGTTAGGCAGATCCAAACCTCGGCTCACAGGGAGTTTACCGATCCCGTTCTCAAT
GCCGTTGTGGCGCTAGCCTACGAGACTGCCTCTTCTGGATTTGGCGCCTTGATATTCGCTAGCAGCCGAAGCCTC
TGCGAGTCGGACGCCCGCTGCATCAGTCGAGTAATGCCCGAGCCTCGTGACATTAGTAGCAGCCTGAGAGATAAA
AGGCTGAACCTGCTTGGCGACTTGCGAAGCTTGAGCTCTGGCGTTGACCCAGTGCTAGAAGAGACGGTCTTGTAC
GGCGTGGCATTTCATCGTGAGTGCCTTGCCTGCGGCTATGCCATGGCACTTGGGCCGAGGCTGACGCGAAGTATA
CAGATCGAGGAGCGTGAGCTGATTGCTGCCGCATACGATGCCGGGACAATTCTTGTCTGCGTGGCAACGTGCAGC
CTCGCCGCTGGCATCAACCTCCCGGCGCGCAGAGTCATATTGCACAACGCTCGCATGGGTCGCGATTTGGTTGGC
CCGTCCATGCTCAGGCAGATGAGAGGTCGGGCTGGACGGCCGGGCAGATGTCCTGTTGGCGAGACATATCTCTGT
TGCCGACAAAGCGACTTGGATCAGGTCCTGGAGCTTATGCAGGCCGAGATGCCAGCAATCTCAAGCTGCTTGAGC
ACTGACAACAGACGGGTTCAACGCGCGCTCTTGGAAGCCATTTCAACCCGTCTGGCAAGCAGCCAAGAATCCATC
AACGACTACTTTGCCAAGTCATTGCTCAGGCATTCACATGGCGGACAATTTGTCAAGGAGTGCACCCAGTCAAGC
CTAGACGAGGTGGAGCGAATGGGCCTGGCGACGTGCGATAGCTTGGGCCACTGGACTCCAACGCAGCTGGGCAAA
GCAATAGTTGCATCGTCTATCGACCCCGACGACGGCGTCTTTGTCCACCGAGAGCTGACCAAGGCGCTGCGGGCG
TTTGCAATGGATGGCGAGATGCACATTTTGTACATCTTCACTCCTGTCCAGGACTTTGGCGTCTCGGTCAACTGG
CAGGTGTTCCGCAACGAGATGGAAGCGCTGGATGACAATGGGCTGCGCGTGCTGAGCTTTGTCGGCATCAAGCCG
ACGGCGCTTCTTCGATTGGCTCAGGGGGGCTCCCTCAAAGAGACAACGCAAGAGGAAAAGGATCAGGCGCGGGTA
TATCGCCGCTTTTACCTGGCGCTTCAGCTTCGCGACCTGTGCAACGAGATGCCAATACACGTTGTTTCTCGCAAG
TACGATATGCCTCGAGGAGCCGTCCAGACTCTGTCGCAGACGTGTCAAGGCTTTGCCGCCGGCATGGTCAAGTTT
TGCGAGCACATGGGATGGGGAGTTATGGCGGCAGCACTAGATCATTTCACAGATCGGCTCATGGCAGGAGCCAGA
GCTGATCTCTTGGCTTTGACCAAGATTCCCTTTATCAAGAGCCGCACAGCGTAA
Gene >OphauB2|4050
ATGAAGAGCATGCAGGGCATCTGGCACAGAACCAGTCTGCAGGAAGCCCAGCAAAGAGTCCAGCAAGATGCCCAG
CAAGATGCCCAGCAAGACGCCCAGCAAGACGCCCAGCAAGACGCCCAGCAAAACGCCCAGGCACAAGGCCAGCCC
AATGGCCGGCTACGAAGCATAGCCACAACACACAGCGGCATCGAGTTCCAGCGCGCAATCAACATCCCTGCTGTC
GCGAGCCGCCTCGAAGCCAGCAACATTGTAGACTTGGGCCAGCCTCCAGTAGTCTCCGAGTACTCGCAGCGGCGC
CATCTTGCGGCCACGCCGTCGTCGTCATGGGATGCAGAGCTCGGTCTTGCTCATGCCGCATATAAGCTCCCGCCT
CAGCTCGTGGCCAACTTTGCCGCCCTGGGCATCACCCAAATGTATCCTTGGCAAAAGAATTGTCTCAAGGGGCCT
GGCCTTCTCAAAGGAGACAAGAACCTCGTCTACTCTGCCCCGACGGGCGGTGGCAAATCCTTGGTCGCTGATTGT
GAGATTTAGTAGAGTCAGTCAAGGCTCAAGTGGCCCGCGTGCCAAGCGCTGACCGCATCCCAGTGCTCATGTTGA
AACGCGTCATTGAGAGTCCAGGCACCAAGGCTCTTGTTGTGCTCCCCTACGTCGCTCTTGTTCAGGAAAAGGTTG
GCTGGCTTCGACGTGTTGTCCGCCAACTACCAAGTCCAGCCGATGCGCCCCAAGCCCATCTAGACAGGCCGGGAC
CTTGGCGACGACGTGCAGACCAAGACACCCTGCGAGTCGTCGGTTTCTTTGGTGGCGGCAAAGTCAGAGCCGCCT
GGGATGATTTTGAAATTGCTGTCTGCACTCTGGAAAAGGTCTGGCCCAGGGGTGCCTTTGTTGCAGCGTGCCTGC
TGACCGACCCTTGCAGGCCAATGCACTTATTAATACGGCCATTGACGATTGCTCCATCGCACCGCTCCGAGCTGT
TGTGCTGGACGAGTTGCACATGATTGACGACGACCATCGCGGCTATCTGCTCGAGCTCATAGGCACCAAGCTGCT
GAGTCTAGAGCAGCCACTTCAAATCATAGGCATGAGCGCCACACTCCCGGTATGATTTTTCAAATCACTGGGGGA
ACCTTGATGGCTTGATTAACACTGCCGGTTGCCAGAACATGGATTTGGTGGCGGCGTGGCTTAATGCACACTGCT
ATGAAACACACTATCGGCCAGTGCCCATCGAGGAACACCTTGTGTATGACAGTAATGTCTTTGCAGTCGCATCTG
TTCAGCCATGGCAGCAAAAGCTTGGGCAGACGACGAGTCTGTCGACTCCAGTTAGGCAGATCCAAACCTCGGCTC
ACAGGGAGTTTACCGATCCCGTTCTCAATGCCGTTGTGGCGCTAGCCTACGAGACTGCCTCTTCTGGATTTGGCG
CCTTGATATTCGCTAGCAGCCGAAGCCTCTGCGAGTCGGACGCCCGCTGCATCAGTCGAGTAATGCCCGAGCCTC
GTGACATTAGTAGCAGCCTGAGAGATAAAAGGCTGAACCTGCTTGGCGACTTGCGAAGCTTGAGCTCTGGCGTTG
ACCCAGTGCTAGAAGAGACGGTCTTGTACGGCGTGGCATTTCATCGTGAGTGCCTTGCCTGCGGCTATGCCATGG
CACTTGGGCCGAGGCTGACGCGAAGTATACAGATGTAATTCCCCAAAGACTCGCCCCTTTGAATTTTACTAAATG
AGCTAGGCTGGATTGACTAGCGAGGAGCGTGAGCTGATTGCTGCCGCATACGATGCCGGGACAATTCTTGTCTGC
GTGGCAACGTGCAGCCTCGCCGCTGGCATCAACCTGTAGGTCCCCATAGGCAGCGTCGGAGGTTGGGGTCTGACA
GTGTATTTGGCAAAGCCCGGCGCGCAGAGTCATATTGCACAACGCTCGCATGGGTCGCGATTTGGTTGGCCCGTC
CATGCTCAGGCAGATGAGAGGTCGGGCTGGACGGCCGGGCAGATGTCCTGTTGGCGAGACATATCTCTGTTGCCG
ACAAAGCGACTTGGATCAGGTCCTGGAGCTTATGCAGGCCGAGATGCCAGCAATCTCAAGCTGCTTGAGCACTGA
CAACAGACGGGTTCAACGGTGAGTCGGCGGCTGATGTTTTGATGCTGGCGTCATGGTAGTGGGATGCTGGCTTGA
CACTGGTCGGTTCTAGCGACTTCTCGCTGACTGGACAATCAGCGCGCTCTTGGAAGCCATTTCAACCCGTCTGGC
AAGCAGCCAAGAATCCATCAACGACTACTTTGCCAAGTCATTGCTCAGGCATTCACATGGCGGACAATTTGTCAA
GGAGTGCACCCAGTCAAGCCTAGACGAGGTGGAGCGAATGGGCCTGGCGACGTGCGATAGCTTGGGCCACTGGAC
TCCAACGCAGCTGGGCAAAGCAATAGTTGCATCGTCTATCGACCCCGACGACGGCGTCTTTGTCCACCGAGAGCT
GACCAAGGCGCTGCGGGCGTTTGCAATGGATGGCGAGATGCACATTTTGTACATCTTCACTCCTGTCCAGGACTT
TGGCGTCTCGGTCAACTGGCAGGTGTTCCGCAACGAGATGGAAGCGCTGGATGACAATGGGCTGCGCGTGCTGAG
CTTTGTCGGCATCAAGCCGACGGCGCTTCTTCGATTGTGAGTTGCGTCGTGGCAGCAGAGACGATGCTGCAGTGG
CTGACACGGCAACCAGGGCTCAGGGGGGCTCCCTCAAAGAGACAACGCAAGAGGAAAAGGATCAGGCGCGGGTAT
ATCGCCGCTTTTACCTGGCGCTTCAGCTTCGCGACCTGTGCAACGAGATGCCAATACACGTTGTTTCTCGCAAGT
ACGATATGCCTCGAGGAGCCGTCCAGACTCTGTCGCAGACGTGTCAAGGCTTTGCCGCCGGCATGGTCAAGTTTT
GCGAGCACATGGGATGGGGGTGAGTCGAGCAATGACGCTTCACTGGCTCAGCTGCGACTGACTGCCTGCATGACG
CAGAGTTATGGCGGCAGCACTAGATCATTTCACAGATCGGCTCATGGCAGGAGCCAGAGCTGATCTCTTGGCTTT
GACCAAGATTCCCTTTATCAAGAGCCGCACAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail