Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4039
Gene name
LocationContig_26:152165..153137
Strand+
Gene length (bp)972
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 4.6E-18 52 301

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 72 91 19
3 136 158 22
4 168 190 22
5 203 220 17
6 267 289 22
7 302 319 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4039
MSAVSLQRRLSTDPRWREMGPLHLLHQARYHAYSIWLFTRSDIKTIILPSLLFSLLTAPALALFDITTPSLALVR
RLPLTLFWIWINLLPFAIDNQRQSDAIAEDGINKPWRVLPSRRMTPRQATILMCCLYPTAVASSLVLGGLEQCLC
LIALGFWYNDLRGADNGFVIRQVINAAGFNRFAMGALTVLLGDKQQFIQTRSFFIWQLILAGIVSTTVQTQDMYD
QEGDAERGRHTVPLDLGDGLARWTIAVPMTLWCIFCPLFVDSPLIGFAISVSMGLLIAIRCLLFRSVASDKITFI
MWNSWLVSIYSLPLLTVAWKQAS*
Coding >OphauB2|4039
ATGTCTGCCGTGTCTCTCCAGCGTCGTCTATCTACAGATCCTCGGTGGAGAGAAATGGGTCCTCTACATCTCCTC
CACCAGGCCCGCTACCACGCCTATTCAATATGGCTCTTTACACGCAGCGACATCAAAACCATTATCCTTCCAAGC
CTTCTCTTCTCCCTCTTGACCGCCCCTGCTCTGGCCTTGTTCGACATCACCACGCCCTCACTTGCCCTTGTCCGC
AGACTGCCACTCACCCTATTCTGGATATGGATCAACCTCCTTCCCTTTGCCATTGACAACCAACGGCAGTCAGAT
GCCATAGCCGAAGACGGTATAAACAAGCCCTGGCGTGTCCTTCCATCACGGCGCATGACTCCTCGTCAGGCAACA
ATTCTCATGTGCTGTCTCTATCCAACGGCCGTCGCCTCCAGCCTTGTTCTCGGCGGCCTTGAGCAGTGCCTCTGC
CTCATAGCCCTTGGCTTCTGGTACAATGATCTTCGCGGCGCCGACAATGGCTTCGTCATTCGTCAAGTAATCAAC
GCCGCCGGCTTCAACCGCTTTGCCATGGGCGCTCTGACTGTCCTGCTCGGCGACAAGCAGCAGTTTATACAGACA
CGCTCCTTTTTCATCTGGCAGCTCATCTTGGCCGGCATTGTCTCAACAACAGTACAGACACAAGACATGTACGAC
CAAGAGGGAGATGCTGAGCGTGGCCGACACACAGTCCCTCTCGATCTGGGCGATGGACTGGCTCGCTGGACCATT
GCCGTGCCCATGACCCTTTGGTGCATCTTTTGCCCCTTGTTTGTCGACAGTCCCTTGATTGGCTTTGCCATTTCC
GTTTCAATGGGCTTGCTCATCGCCATTAGATGTCTCCTATTCAGGAGCGTGGCGTCTGACAAGATTACCTTCATC
ATGTGGAACTCGTGGCTGGTTTCTATATACTCATTGCCACTTTTGACAGTAGCTTGGAAGCAAGCTTCATAA
Transcript >OphauB2|4039
ATGTCTGCCGTGTCTCTCCAGCGTCGTCTATCTACAGATCCTCGGTGGAGAGAAATGGGTCCTCTACATCTCCTC
CACCAGGCCCGCTACCACGCCTATTCAATATGGCTCTTTACACGCAGCGACATCAAAACCATTATCCTTCCAAGC
CTTCTCTTCTCCCTCTTGACCGCCCCTGCTCTGGCCTTGTTCGACATCACCACGCCCTCACTTGCCCTTGTCCGC
AGACTGCCACTCACCCTATTCTGGATATGGATCAACCTCCTTCCCTTTGCCATTGACAACCAACGGCAGTCAGAT
GCCATAGCCGAAGACGGTATAAACAAGCCCTGGCGTGTCCTTCCATCACGGCGCATGACTCCTCGTCAGGCAACA
ATTCTCATGTGCTGTCTCTATCCAACGGCCGTCGCCTCCAGCCTTGTTCTCGGCGGCCTTGAGCAGTGCCTCTGC
CTCATAGCCCTTGGCTTCTGGTACAATGATCTTCGCGGCGCCGACAATGGCTTCGTCATTCGTCAAGTAATCAAC
GCCGCCGGCTTCAACCGCTTTGCCATGGGCGCTCTGACTGTCCTGCTCGGCGACAAGCAGCAGTTTATACAGACA
CGCTCCTTTTTCATCTGGCAGCTCATCTTGGCCGGCATTGTCTCAACAACAGTACAGACACAAGACATGTACGAC
CAAGAGGGAGATGCTGAGCGTGGCCGACACACAGTCCCTCTCGATCTGGGCGATGGACTGGCTCGCTGGACCATT
GCCGTGCCCATGACCCTTTGGTGCATCTTTTGCCCCTTGTTTGTCGACAGTCCCTTGATTGGCTTTGCCATTTCC
GTTTCAATGGGCTTGCTCATCGCCATTAGATGTCTCCTATTCAGGAGCGTGGCGTCTGACAAGATTACCTTCATC
ATGTGGAACTCGTGGCTGGTTTCTATATACTCATTGCCACTTTTGACAGTAGCTTGGAAGCAAGCTTCATAA
Gene >OphauB2|4039
ATGTCTGCCGTGTCTCTCCAGCGTCGTCTATCTACAGATCCTCGGTGGAGAGAAATGGGTCCTCTACATCTCCTC
CACCAGGCCCGCTACCACGCCTATTCAATATGGCTCTTTACACGCAGCGACATCAAAACCATTATCCTTCCAAGC
CTTCTCTTCTCCCTCTTGACCGCCCCTGCTCTGGCCTTGTTCGACATCACCACGCCCTCACTTGCCCTTGTCCGC
AGACTGCCACTCACCCTATTCTGGATATGGATCAACCTCCTTCCCTTTGCCATTGACAACCAACGGCAGTCAGAT
GCCATAGCCGAAGACGGTATAAACAAGCCCTGGCGTGTCCTTCCATCACGGCGCATGACTCCTCGTCAGGCAACA
ATTCTCATGTGCTGTCTCTATCCAACGGCCGTCGCCTCCAGCCTTGTTCTCGGCGGCCTTGAGCAGTGCCTCTGC
CTCATAGCCCTTGGCTTCTGGTACAATGATCTTCGCGGCGCCGACAATGGCTTCGTCATTCGTCAAGTAATCAAC
GCCGCCGGCTTCAACCGCTTTGCCATGGGCGCTCTGACTGTCCTGCTCGGCGACAAGCAGCAGTTTATACAGACA
CGCTCCTTTTTCATCTGGCAGCTCATCTTGGCCGGCATTGTCTCAACAACAGTACAGACACAAGACATGTACGAC
CAAGAGGGAGATGCTGAGCGTGGCCGACACACAGTCCCTCTCGATCTGGGCGATGGACTGGCTCGCTGGACCATT
GCCGTGCCCATGACCCTTTGGTGCATCTTTTGCCCCTTGTTTGTCGACAGTCCCTTGATTGGCTTTGCCATTTCC
GTTTCAATGGGCTTGCTCATCGCCATTAGATGTCTCCTATTCAGGAGCGTGGCGTCTGACAAGATTACCTTCATC
ATGTGGAACTCGTGGCTGGTTTCTATATACTCATTGCCACTTTTGACAGTAGCTTGGAAGCAAGCTTCATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail