Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4037
Gene name
LocationContig_26:144342..147892
Strand+
Gene length (bp)3550
Transcript length (bp)3201
Coding sequence length (bp)3201
Protein length (aa) 1067

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 4.5E-25 705 942
PF00501 AMP-binding AMP-binding enzyme 8.6E-23 43 356
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.2E-04 701 897

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 410 994 5.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 553 991 2.0E-14
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 594 951 5.0E-10
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 701 1001 9.0E-10
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 635 994 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 410 994 5.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 553 991 2.0E-14
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 594 951 5.0E-10
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 701 1001 9.0E-10
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 635 994 3.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 579 994 7.0E-09
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 406 948 7.0E-09
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 699 1000 1.0E-08
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 703 1001 2.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 590 997 5.0E-08
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 701 1001 7.0E-08
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 703 1007 1.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 703 1001 1.0E-07
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 703 1007 1.0E-07
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 766 1001 1.0E-07
sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 700 942 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4037
MASLPPHDYGKRLLPQVVDWYARHDAGKLYASLPRSATDLAAGFQDISMAMLAAMVNRMSWHFEAVLGRGSLESI
AYLGPADIRYAVLFLAAVKAGYQMLFISPRNQSAQNQRMLVMSSCKALLYAQELCAAAEPLAARLPALVVQQAPL
LDDLVATPLATQHYPYDKTFDEARDEPCLILHSSGSTGMNGLTSVCVCVFCACDPKLVTMTHGTFSVVDNDRTMA
VPEGRVAQNAARFDFERGGKFYSCFPPYHLAGVHAFIDLPIFYHGATVVFGPVNLPPSGYLLSEIVKMQHLRAFY
VPPFIIEQWAAEPCSMQQAPTLDFVLYGGGPLSPQTGDRLSRATSVCQMYGSLELGQIQLLVPERAEWAHMELNP
HEEADMQPLGDGTYEMVLHQHEKFATRRSLWHNFPGVQTWRTGDLFLPHPSKQGLWRFHSRVDDLVVLSSSHKLR
PLEMETIIQGHELVAGAIIVGQGKPEPLLIVEPREGAFNGHEPRFIDAIWTAVQEANEIAPSYAQIKRSNVLVSK
PERPFIRAPKGSIVRKLTIAAYADDIEAAYAADAPPSKATMPAQGMDGFVLPGLKQMVRAHVEDELPGVTISDAD
SLFARGLDSMGCARLSRSLQKTLAAQGSTDGSCALTMRMIYKYPSIEGLATVVLNIVFNRTLPDVSIGSDTKMMK
SALETLTQNLPARKATRAAPTEALTIVLIGPRGSLGPHIVRQLLQSRRVAKIYSLNRGQHGRERMRALVKQRGLA
LDVDDARLCFMPFELGKPHLGLSDEDYALVLRSANLVIHNAWKIDFNWTIEQYQADYLPSVRHLVDFSAESPLSP
RIVFISSISSVQEWAAVFPTPVTEEPLESFQVASPLGYGQSKHVSERILTAASAISGTPVTILRVGQIAGSTTGS
GGAWTPDEWVPSLASISRSLNKVPVDIPPIDWVPANLAAQAIAELALNDSCPPLRVFNIVNPKLSPWFTFVKALQ
SRLGDSVQAVTLAEWVSALVGTDPKSMSDAAATSSTKLLPFFQHLAQTAAKGVALQPRFETGKAMGASETMAGMA
AIDERVIDIWLQQWDI*
Coding >OphauB2|4037
ATGGCCTCGTTGCCGCCTCACGACTACGGCAAGCGCCTCTTGCCCCAAGTGGTCGACTGGTATGCCCGCCACGAT
GCGGGAAAGCTCTACGCCAGTCTGCCCAGGTCGGCAACAGATCTGGCAGCCGGCTTCCAGGACATTTCCATGGCC
ATGCTGGCCGCCATGGTGAACCGCATGTCGTGGCATTTCGAAGCTGTGCTTGGCCGGGGCAGCCTCGAGTCTATT
GCCTATCTCGGCCCGGCGGATATTCGATACGCCGTCTTGTTTCTCGCGGCCGTCAAGGCGGGATACCAGATGCTC
TTCATCTCCCCCCGGAACCAATCAGCACAGAACCAGCGCATGCTCGTCATGTCGTCATGCAAGGCGCTTCTTTAC
GCCCAGGAGCTCTGCGCGGCTGCTGAGCCGCTCGCCGCTCGCCTCCCCGCGCTGGTGGTGCAGCAGGCGCCGCTG
CTGGACGACTTGGTGGCCACGCCGCTCGCCACGCAGCATTACCCCTACGACAAGACATTTGACGAGGCTCGCGAT
GAGCCTTGTCTGATTCTGCACTCGTCGGGGTCGACAGGTATGAATGGCTTGACAAGCGTGTGTGTGTGTGTGTTT
TGCGCGTGTGATCCAAAGCTCGTGACAATGACGCACGGTACCTTTTCCGTGGTGGACAATGATCGCACCATGGCT
GTTCCAGAGGGACGTGTGGCGCAAAATGCAGCGCGTTTCGACTTTGAGCGAGGGGGCAAGTTTTATTCTTGTTTT
CCCCCCTATCATCTTGCCGGCGTCCACGCCTTCATCGACCTACCCATCTTCTACCATGGCGCCACCGTCGTCTTT
GGCCCAGTCAACCTCCCCCCCAGCGGCTACCTCCTCTCTGAAATCGTCAAGATGCAGCACCTGCGCGCCTTTTAC
GTCCCGCCCTTCATCATTGAGCAATGGGCCGCCGAGCCGTGCTCCATGCAGCAAGCTCCAACCCTCGACTTTGTC
CTCTATGGCGGCGGGCCCCTCTCCCCCCAAACAGGCGACAGACTGAGCCGCGCCACCAGCGTCTGCCAAATGTAC
GGCTCGCTTGAACTCGGCCAGATCCAGCTGCTGGTGCCGGAGCGCGCCGAGTGGGCGCACATGGAGCTGAATCCG
CATGAAGAGGCCGACATGCAGCCCCTGGGCGACGGCACGTATGAAATGGTGCTGCACCAGCATGAAAAGTTTGCC
ACGCGCCGCAGCCTGTGGCACAACTTCCCTGGCGTGCAGACGTGGCGCACAGGAGACTTGTTTCTGCCCCATCCG
TCAAAACAGGGGCTGTGGCGCTTCCACTCGCGAGTCGACGACTTGGTGGTGCTGTCGAGCAGCCATAAGCTCCGC
CCGCTCGAGATGGAGACGATTATCCAGGGCCATGAGCTTGTTGCCGGAGCTATTATTGTCGGGCAGGGCAAGCCG
GAGCCGCTGCTCATTGTCGAGCCGAGAGAGGGCGCCTTCAACGGCCACGAGCCGCGCTTCATTGATGCTATTTGG
ACAGCGGTGCAGGAAGCAAACGAAATTGCACCCAGCTACGCGCAGATTAAGCGCAGCAATGTCCTCGTCTCCAAG
CCTGAGCGGCCCTTTATCCGCGCCCCCAAAGGCAGCATTGTTCGCAAACTCACCATTGCGGCCTATGCCGACGAC
ATTGAAGCTGCCTACGCCGCCGACGCTCCGCCAAGCAAGGCGACAATGCCGGCACAGGGCATGGATGGCTTCGTC
TTGCCCGGGCTGAAGCAAATGGTGCGCGCCCACGTTGAAGACGAGCTTCCCGGCGTCACCATTTCAGACGCGGAT
AGCTTGTTTGCCCGCGGCCTCGACTCCATGGGCTGCGCGCGTCTGAGCCGGAGCTTGCAAAAGACGCTGGCGGCT
CAGGGCAGCACCGACGGAAGCTGTGCCTTGACGATGCGCATGATTTACAAGTATCCCTCCATAGAGGGCCTGGCA
ACGGTGGTGCTAAACATTGTCTTTAACCGCACGCTGCCCGACGTGTCGATTGGAAGCGACACCAAGATGATGAAG
AGCGCGCTCGAGACGCTCACGCAGAACCTGCCCGCCAGAAAAGCAACACGTGCTGCTCCTACCGAGGCCCTGACT
ATTGTCTTGATTGGGCCGCGTGGGTCGCTGGGGCCTCATATTGTGCGCCAGCTGCTGCAGAGTCGTCGAGTGGCC
AAGATTTACAGTCTGAATAGGGGGCAGCATGGCCGAGAGAGGATGCGCGCCCTCGTCAAGCAGCGAGGCTTGGCT
CTCGACGTGGACGATGCTCGTCTGTGTTTTATGCCGTTTGAGCTTGGCAAACCCCATCTCGGTCTCAGTGACGAG
GATTACGCTCTCGTGCTGCGCAGCGCCAACCTCGTCATTCACAATGCGTGGAAAATCGACTTCAACTGGACCATT
GAGCAGTACCAGGCCGACTATCTGCCCAGCGTGCGCCATCTCGTCGACTTTTCCGCCGAGAGCCCTCTCTCGCCT
CGCATCGTCTTCATCTCTTCCATTTCTTCTGTTCAGGAATGGGCCGCTGTTTTCCCCACCCCCGTGACTGAAGAG
CCTCTTGAATCCTTCCAGGTCGCCTCGCCTCTGGGCTACGGCCAGTCCAAGCACGTTTCTGAGCGCATCCTCACG
GCAGCGAGTGCCATTTCCGGCACCCCAGTCACCATTCTCCGCGTCGGCCAGATTGCCGGCTCGACTACGGGAAGC
GGCGGCGCCTGGACTCCTGATGAATGGGTTCCCTCGCTCGCCTCCATTTCTCGCTCCCTCAACAAAGTCCCCGTC
GATATTCCGCCCATTGACTGGGTTCCCGCCAATCTCGCCGCCCAAGCCATTGCTGAGCTCGCTCTCAACGACTCT
TGTCCTCCTCTCCGCGTTTTCAACATTGTCAATCCAAAGCTCTCTCCTTGGTTTACCTTTGTTAAAGCCCTGCAG
AGCCGTCTGGGAGACTCTGTGCAGGCGGTTACGCTGGCAGAATGGGTATCTGCCCTTGTGGGCACAGATCCAAAG
TCCATGTCGGATGCGGCTGCCACGTCTTCGACCAAGCTGCTTCCCTTTTTCCAGCACTTGGCGCAGACGGCGGCA
AAGGGCGTTGCGCTGCAGCCGAGGTTTGAGACGGGCAAGGCCATGGGGGCTAGTGAGACCATGGCTGGCATGGCG
GCCATTGATGAGCGTGTTATTGACATTTGGCTTCAGCAGTGGGATATTTGA
Transcript >OphauB2|4037
ATGGCCTCGTTGCCGCCTCACGACTACGGCAAGCGCCTCTTGCCCCAAGTGGTCGACTGGTATGCCCGCCACGAT
GCGGGAAAGCTCTACGCCAGTCTGCCCAGGTCGGCAACAGATCTGGCAGCCGGCTTCCAGGACATTTCCATGGCC
ATGCTGGCCGCCATGGTGAACCGCATGTCGTGGCATTTCGAAGCTGTGCTTGGCCGGGGCAGCCTCGAGTCTATT
GCCTATCTCGGCCCGGCGGATATTCGATACGCCGTCTTGTTTCTCGCGGCCGTCAAGGCGGGATACCAGATGCTC
TTCATCTCCCCCCGGAACCAATCAGCACAGAACCAGCGCATGCTCGTCATGTCGTCATGCAAGGCGCTTCTTTAC
GCCCAGGAGCTCTGCGCGGCTGCTGAGCCGCTCGCCGCTCGCCTCCCCGCGCTGGTGGTGCAGCAGGCGCCGCTG
CTGGACGACTTGGTGGCCACGCCGCTCGCCACGCAGCATTACCCCTACGACAAGACATTTGACGAGGCTCGCGAT
GAGCCTTGTCTGATTCTGCACTCGTCGGGGTCGACAGGTATGAATGGCTTGACAAGCGTGTGTGTGTGTGTGTTT
TGCGCGTGTGATCCAAAGCTCGTGACAATGACGCACGGTACCTTTTCCGTGGTGGACAATGATCGCACCATGGCT
GTTCCAGAGGGACGTGTGGCGCAAAATGCAGCGCGTTTCGACTTTGAGCGAGGGGGCAAGTTTTATTCTTGTTTT
CCCCCCTATCATCTTGCCGGCGTCCACGCCTTCATCGACCTACCCATCTTCTACCATGGCGCCACCGTCGTCTTT
GGCCCAGTCAACCTCCCCCCCAGCGGCTACCTCCTCTCTGAAATCGTCAAGATGCAGCACCTGCGCGCCTTTTAC
GTCCCGCCCTTCATCATTGAGCAATGGGCCGCCGAGCCGTGCTCCATGCAGCAAGCTCCAACCCTCGACTTTGTC
CTCTATGGCGGCGGGCCCCTCTCCCCCCAAACAGGCGACAGACTGAGCCGCGCCACCAGCGTCTGCCAAATGTAC
GGCTCGCTTGAACTCGGCCAGATCCAGCTGCTGGTGCCGGAGCGCGCCGAGTGGGCGCACATGGAGCTGAATCCG
CATGAAGAGGCCGACATGCAGCCCCTGGGCGACGGCACGTATGAAATGGTGCTGCACCAGCATGAAAAGTTTGCC
ACGCGCCGCAGCCTGTGGCACAACTTCCCTGGCGTGCAGACGTGGCGCACAGGAGACTTGTTTCTGCCCCATCCG
TCAAAACAGGGGCTGTGGCGCTTCCACTCGCGAGTCGACGACTTGGTGGTGCTGTCGAGCAGCCATAAGCTCCGC
CCGCTCGAGATGGAGACGATTATCCAGGGCCATGAGCTTGTTGCCGGAGCTATTATTGTCGGGCAGGGCAAGCCG
GAGCCGCTGCTCATTGTCGAGCCGAGAGAGGGCGCCTTCAACGGCCACGAGCCGCGCTTCATTGATGCTATTTGG
ACAGCGGTGCAGGAAGCAAACGAAATTGCACCCAGCTACGCGCAGATTAAGCGCAGCAATGTCCTCGTCTCCAAG
CCTGAGCGGCCCTTTATCCGCGCCCCCAAAGGCAGCATTGTTCGCAAACTCACCATTGCGGCCTATGCCGACGAC
ATTGAAGCTGCCTACGCCGCCGACGCTCCGCCAAGCAAGGCGACAATGCCGGCACAGGGCATGGATGGCTTCGTC
TTGCCCGGGCTGAAGCAAATGGTGCGCGCCCACGTTGAAGACGAGCTTCCCGGCGTCACCATTTCAGACGCGGAT
AGCTTGTTTGCCCGCGGCCTCGACTCCATGGGCTGCGCGCGTCTGAGCCGGAGCTTGCAAAAGACGCTGGCGGCT
CAGGGCAGCACCGACGGAAGCTGTGCCTTGACGATGCGCATGATTTACAAGTATCCCTCCATAGAGGGCCTGGCA
ACGGTGGTGCTAAACATTGTCTTTAACCGCACGCTGCCCGACGTGTCGATTGGAAGCGACACCAAGATGATGAAG
AGCGCGCTCGAGACGCTCACGCAGAACCTGCCCGCCAGAAAAGCAACACGTGCTGCTCCTACCGAGGCCCTGACT
ATTGTCTTGATTGGGCCGCGTGGGTCGCTGGGGCCTCATATTGTGCGCCAGCTGCTGCAGAGTCGTCGAGTGGCC
AAGATTTACAGTCTGAATAGGGGGCAGCATGGCCGAGAGAGGATGCGCGCCCTCGTCAAGCAGCGAGGCTTGGCT
CTCGACGTGGACGATGCTCGTCTGTGTTTTATGCCGTTTGAGCTTGGCAAACCCCATCTCGGTCTCAGTGACGAG
GATTACGCTCTCGTGCTGCGCAGCGCCAACCTCGTCATTCACAATGCGTGGAAAATCGACTTCAACTGGACCATT
GAGCAGTACCAGGCCGACTATCTGCCCAGCGTGCGCCATCTCGTCGACTTTTCCGCCGAGAGCCCTCTCTCGCCT
CGCATCGTCTTCATCTCTTCCATTTCTTCTGTTCAGGAATGGGCCGCTGTTTTCCCCACCCCCGTGACTGAAGAG
CCTCTTGAATCCTTCCAGGTCGCCTCGCCTCTGGGCTACGGCCAGTCCAAGCACGTTTCTGAGCGCATCCTCACG
GCAGCGAGTGCCATTTCCGGCACCCCAGTCACCATTCTCCGCGTCGGCCAGATTGCCGGCTCGACTACGGGAAGC
GGCGGCGCCTGGACTCCTGATGAATGGGTTCCCTCGCTCGCCTCCATTTCTCGCTCCCTCAACAAAGTCCCCGTC
GATATTCCGCCCATTGACTGGGTTCCCGCCAATCTCGCCGCCCAAGCCATTGCTGAGCTCGCTCTCAACGACTCT
TGTCCTCCTCTCCGCGTTTTCAACATTGTCAATCCAAAGCTCTCTCCTTGGTTTACCTTTGTTAAAGCCCTGCAG
AGCCGTCTGGGAGACTCTGTGCAGGCGGTTACGCTGGCAGAATGGGTATCTGCCCTTGTGGGCACAGATCCAAAG
TCCATGTCGGATGCGGCTGCCACGTCTTCGACCAAGCTGCTTCCCTTTTTCCAGCACTTGGCGCAGACGGCGGCA
AAGGGCGTTGCGCTGCAGCCGAGGTTTGAGACGGGCAAGGCCATGGGGGCTAGTGAGACCATGGCTGGCATGGCG
GCCATTGATGAGCGTGTTATTGACATTTGGCTTCAGCAGTGGGATATTTGA
Gene >OphauB2|4037
ATGGCCTCGTTGCCGCCTCACGACTACGGCAAGCGCCTCTTGCCCCAAGTGGTCGACTGGTATGCCCGCCACGAT
GCGGGAAAGCTCTACGCCAGTCTGCCCAGGTCGGCAACAGATCTGGCAGCCGGCTTCCAGGACATTTCCATGGCC
ATGCTGGCCGCCATGGTGAACCGCATGTCGTGGCATTTCGAAGCTGTGCTTGGCCGGGGCAGCCTCGAGTCTATT
GCCTATCTCGGCCCGGCGGATATTCGATACGCCGTCTTGTTTCTCGCGGCCGTCAAGGCGGGATACCAGGCACGT
AGTCTCGTCATGTTTTTACCCCCCCCCCTGAAGAGAGCCTCATGATGTACAATCATCTACAAACCTGAAAGAAGG
AAATCATTATTAAAAAAAAATAGATGAAACGAATAAAGACAAAAGAGACAAAAAGGGTGACGAGGGAAAAAAAAA
AAAAAATCTCCGACTAACCTCGTCTCCTTAGATGCTCTTCATCTCCCCCCGGAACCAATCAGCACAGAACCAGCG
CATGCTCGTCATGTCGTCATGCAAGGCGCTTCTTTACGCCCAGGAGCTCTGCGCGGCTGCTGAGCCGCTCGCCGC
TCGCCTCCCCGCGCTGGTGGTGCAGCAGGCGCCGCTGCTGGACGACTTGGTGGCCACGCCGCTCGCCACGCAGCA
TTACCCCTACGACAAGACATTTGACGAGGCTCGCGATGAGCCTTGTCTGATTCTGCACTCGTCGGGGTCGACAGG
TATGAATGGCTTGACAAGCGTGTGTGTGTGTGTGTTTTGCGCGTGTGAGTGGGTTGTAGATGGGGCCTTTTTGTC
TAATAGCCCTTGTGCCGCGCGTCTCAGGTGATCCAAAGCTCGTGACAATGACGCACGGTACCTTTTCCGTGGTGG
ACAATGATCGCACCATGGCTGTTCCAGAGGGACGTGTGGCGCAAAATGCAGCGCGTTTCGACTTTGAGCGAGGGG
GCAAGTTTTATTCTTGTTTTCCCCCCTATCATGTAAGTTTTGCCTAGCAGTCACTTCTTGTCTTTTCGTCGAGTC
TTGCTTCAACTCTTGTCTTTTCTTCCTCTTCACCTCTTGCATATTGTCTGACAATCTATAGCTTGCCGGCGTCCA
CGCCTTCATCGACCTACCCATCTTCTACCATGGCGCCACCGTCGTCTTTGGCCCAGTCAACCTCCCCCCCAGCGG
CTACCTCCTCTCTGAAATCGTCAAGATGCAGCACCTGCGCGCCTTTTACGTCCCGCCCTTCATCATTGAGCAATG
GGCCGCCGAGCCGTGCTCCATGCAGCAAGCTCCAACCCTCGACTTTGTCCTCTATGGCGGCGGGCCCCTCTCCCC
CCAAACAGGCGACAGACTGAGCCGCGCCACCAGCGTCTGCCAAATGTACGGCTCGCTTGAACTCGGCCAGATCCA
GCTGCTGGTGCCGGAGCGCGCCGAGTGGGCGCACATGGAGCTGAATCCGCATGAAGAGGCCGACATGCAGCCCCT
GGGCGACGGCACGTATGAAATGGTGCTGCACCAGCATGAAAAGTTTGCCACGCGCCGCAGCCTGTGGCACAACTT
CCCTGGCGTGCAGACGTGGCGCACAGGAGACTTGTTTCTGCCCCATCCGTCAAAACAGGGGCTGTGGCGCTTCCA
CTCGCGAGTCGACGACTTGGTGGTGCTGTCGAGCAGCCATAAGCTCCGCCCGCTCGAGATGGAGACGATTATCCA
GGGCCATGAGCTTGTTGCCGGAGCTATTATTGTCGGGCAGGGCAAGCCGGAGCCGCTGCTCATTGTCGAGCCGAG
AGAGGGCGCCTTCAACGGCCACGAGCCGCGCTTCATTGATGCTATTTGGACAGCGGTGCAGGAAGCAAACGAAAT
TGCACCCAGCTACGCGCAGATTAAGCGCAGCAATGTCCTCGTCTCCAAGCCTGAGCGGCCCTTTATCCGCGCCCC
CAAAGGCAGCATTGTTCGCAAACTCACCATTGCGGCCTATGCCGACGACATTGAAGCTGCCTACGCCGCCGACGC
TCCGCCAAGCAAGGCGACAATGCCGGCACAGGGCATGGATGGCTTCGTCTTGCCCGGGCTGAAGCAAATGGTGCG
CGCCCACGTTGAAGACGAGCTTCCCGGCGTCACCATTTCAGACGCGGATAGCTTGTTTGCCCGCGGCCTCGACTC
CATGGGCTGCGCGCGTCTGAGCCGGAGCTTGCAAAAGACGCTGGCGGCTCAGGGCAGCACCGACGGAAGCTGTGC
CTTGACGATGCGCATGATTTACAAGTATCCCTCCATAGAGGGCCTGGCAACGGTGGTGCTAAACATTGTCTTTAA
CCGCACGCTGCCCGACGTGTCGATTGGAAGCGACACCAAGATGATGAAGAGCGCGCTCGAGACGCTCACGCAGAA
CCTGCCCGCCAGAAAAGCAACACGTGCTGCTCCTACCGAGGCCCTGACTATTGTCTTGATTGGGCCGCGTGGGTC
GCTGGGGCCTCATATTGTGCGCCAGCTGCTGCAGAGTCGTCGAGTGGCCAAGATTTACAGTCTGAATAGGGGGCA
GCATGGCCGAGAGAGGATGCGCGCCCTCGTCAAGCAGCGAGGCTTGGCTCTCGACGTGGACGATGCTCGTCTGTG
TTTTATGCCGTTTGAGCTTGGCAAACCCCATCTCGGTCTCAGTGACGAGGATTACGCTCTCGTGCTGCGCAGCGC
CAACCTCGTCATTCACAATGCGTGGAAAATCGACTTCAACTGGACCATTGAGCAGTACCAGGCCGACTATCTGCC
CAGCGTGCGCCATCTCGTCGACTTTTCCGCCGAGAGCCCTCTCTCGCCTCGCATCGTCTTCATCTCTTCCATTTC
TTCTGTTCAGGAATGGGCCGCTGTTTTCCCCACCCCCGTGACTGAAGAGCCTCTTGAATCCTTCCAGGTCGCCTC
GCCTCTGGGCTACGGCCAGTCCAAGCACGTTTCTGAGCGCATCCTCACGGCAGCGAGTGCCATTTCCGGCACCCC
AGTCACCATTCTCCGCGTCGGCCAGATTGCCGGCTCGACTACGGGAAGCGGCGGCGCCTGGACTCCTGATGAATG
GGTTCCCTCGCTCGCCTCCATTTCTCGCTCCCTCAACAAAGTCCCCGTCGATATTCCGCCCATTGACTGGGTTCC
CGCCAATCTCGCCGCCCAAGCCATTGCTGAGCTCGCTCTCAACGACTCTTGTCCTCCTCTCCGCGTTTTCAACAT
TGTCAATCCAAAGCTCTCTCCTTGGTTTACCTTTGTTAAAGCCCTGCAGAGCCGTCTGGGAGACTCTGTGCAGGC
GGTTACGCTGGCAGAATGGGTATCTGCCCTTGTGGGCACAGATCCAAAGTCCATGTCGGATGCGGCTGCCACGTC
TTCGACCAAGCTGCTTCCCTTTTTCCAGCACTTGGCGCAGACGGCGGCAAAGGGCGTTGCGCTGCAGCCGAGGTT
TGAGACGGGCAAGGCCATGGGGGCTAGTGAGACCATGGCTGGCATGGCGGCCATTGATGAGCGTGTTATTGACAT
TTGGCTTCAGCAGTGGGATATTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail