Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4029
Gene name
LocationContig_26:125673..126141
Strand-
Gene length (bp)468
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 7.6E-15 63 138

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 19 147 3.0E-14
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 18 147 5.0E-14
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 18 147 5.0E-14
sp|P87304|YB22_SCHPO Putative esterase C31F10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.02 PE=3 SV=1 16 148 1.0E-12
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 58 144 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 19 147 3.0E-14
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 18 147 5.0E-14
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 18 147 5.0E-14
sp|P87304|YB22_SCHPO Putative esterase C31F10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.02 PE=3 SV=1 16 148 1.0E-12
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 58 144 2.0E-08
sp|Q9I644|Y474_PSEAE Putative esterase PA0474 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0474 PE=3 SV=1 24 138 6.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5037
Ophiocordyceps australis map64 (Brazil) OphauB2|4029 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06999
Ophiocordyceps subramaniannii Hirsu2|1027

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4029
MPVPSSPDEDVIRTNLVQRLLARLVSASPIYASTLSTLALSCVERGLVLATLTLTPVHVNSRGSLHGAVSATIVD
LVTGLAIASWDGRGSTGASVDMHLSYLSTAAVGDEVQIEARAQRVGGSLAFVTVRIMRGQEVVTLGQHTKYVKGT
APALV*
Coding >OphauB2|4029
ATGCCCGTCCCCTCGTCCCCCGATGAAGACGTTATCCGCACCAATCTCGTACAGCGCCTTCTCGCGCGCCTCGTC
AGCGCCAGCCCCATCTACGCCTCTACTCTCTCGACGCTCGCCCTCTCTTGTGTCGAGCGCGGCCTCGTGCTCGCG
ACGTTAACCCTGACGCCAGTACACGTGAATAGCCGGGGCAGTCTGCACGGCGCCGTGTCGGCCACGATTGTGGAC
TTGGTGACGGGGCTGGCGATTGCGTCGTGGGATGGGCGCGGGTCGACGGGCGCGAGCGTGGACATGCATCTAAGC
TATCTAAGCACAGCGGCCGTGGGGGATGAGGTGCAGATTGAGGCTAGGGCGCAGCGGGTGGGGGGCAGCTTGGCG
TTTGTAACGGTGCGCATCATGAGGGGCCAAGAGGTGGTGACGCTGGGGCAGCACACCAAGTATGTCAAGGGCACG
GCGCCGGCACTCGTCTAA
Transcript >OphauB2|4029
ATGCCCGTCCCCTCGTCCCCCGATGAAGACGTTATCCGCACCAATCTCGTACAGCGCCTTCTCGCGCGCCTCGTC
AGCGCCAGCCCCATCTACGCCTCTACTCTCTCGACGCTCGCCCTCTCTTGTGTCGAGCGCGGCCTCGTGCTCGCG
ACGTTAACCCTGACGCCAGTACACGTGAATAGCCGGGGCAGTCTGCACGGCGCCGTGTCGGCCACGATTGTGGAC
TTGGTGACGGGGCTGGCGATTGCGTCGTGGGATGGGCGCGGGTCGACGGGCGCGAGCGTGGACATGCATCTAAGC
TATCTAAGCACAGCGGCCGTGGGGGATGAGGTGCAGATTGAGGCTAGGGCGCAGCGGGTGGGGGGCAGCTTGGCG
TTTGTAACGGTGCGCATCATGAGGGGCCAAGAGGTGGTGACGCTGGGGCAGCACACCAAGTATGTCAAGGGCACG
GCGCCGGCACTCGTCTAA
Gene >OphauB2|4029
ATGCCCGTCCCCTCGTCCCCCGATGAAGACGTTATCCGCACCAATCTCGTACAGCGCCTTCTCGCGCGCCTCGTC
AGCGCCAGCCCCATCTACGCCTCTACTCTCTCGACGCTCGCCCTCTCTTGTGTCGAGCGCGGCCTCGTGCTCGCG
ACGTTAACCCTGACGCCAGTACACGTGAATAGCCGGGGCAGTCTGCACGGCGCCGTGTCGGCCACGATTGTGGAC
TTGGTGACGGGGCTGGCGATTGCGTCGTGGGATGGGCGCGGGTCGACGGGCGCGAGCGTGGACATGCATCTAAGC
TATCTAAGCACAGCGGCCGTGGGGGATGAGGTGCAGATTGAGGCTAGGGCGCAGCGGGTGGGGGGCAGCTTGGCG
TTTGTAACGGTGCGCATCATGAGGGGCCAAGAGGTGGTGACGCTGGGGCAGCACACCAAGTATGTCAAGGGCACG
GCGCCGGCACTCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail