Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4027
Gene name
LocationContig_26:122696..124025
Strand-
Gene length (bp)1329
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03824 NicO High-affinity nickel-transport protein 2.4E-72 54 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74869|NIC1_SCHPO High-affinity nickel transport protein nic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nic1 PE=3 SV=3 6 369 8.0E-94
sp|P23516|HOXN_CUPNH High-affinity nickel transport protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxN PE=1 SV=3 13 376 4.0E-75
sp|Q45247|HUPN_BRADU Hydrogenase nickel incorporation protein HupN OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hupN PE=3 SV=1 29 364 6.0E-53
sp|Q48262|NIXA_HELPY High-affinity nickel-transport protein NixA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nixA PE=1 SV=2 41 371 5.0E-46
sp|Q9ZM74|NIXA_HELPJ High-affinity nickel-transport protein NixA OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nixA PE=3 SV=1 41 371 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74869|NIC1_SCHPO High-affinity nickel transport protein nic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nic1 PE=3 SV=3 6 369 8.0E-94
sp|P23516|HOXN_CUPNH High-affinity nickel transport protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxN PE=1 SV=3 13 376 4.0E-75
sp|Q45247|HUPN_BRADU Hydrogenase nickel incorporation protein HupN OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hupN PE=3 SV=1 29 364 6.0E-53
sp|Q48262|NIXA_HELPY High-affinity nickel-transport protein NixA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nixA PE=1 SV=2 41 371 5.0E-46
sp|Q9ZM74|NIXA_HELPJ High-affinity nickel-transport protein NixA OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nixA PE=3 SV=1 41 371 1.0E-45
sp|P96454|NHLF_RHORH Cobalt transport protein NhlF OS=Rhodococcus rhodochrous GN=nhlF PE=1 SV=1 55 367 7.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0015099 nickel cation transmembrane transporter activity Yes
GO:0035444 nickel cation transmembrane transport Yes
GO:0005887 integral component of plasma membrane Yes
GO:0008150 biological_process No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0030001 metal ion transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0031226 intrinsic component of plasma membrane No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006812 cation transport No
GO:0000041 transition metal ion transport No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0098655 cation transmembrane transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0005215 transporter activity No
GO:0055085 transmembrane transport No
GO:0009987 cellular process No
GO:0098660 inorganic ion transmembrane transport No
GO:0046873 metal ion transmembrane transporter activity No
GO:0016021 integral component of membrane No
GO:0015675 nickel cation transport No
GO:0034220 ion transmembrane transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 93 115 22
3 130 152 22
4 220 242 22
5 252 269 17
6 290 312 22
7 341 363 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4027
MPRNLNLLVEKPRLLRGIPSNSIAIITLLITTNLATWAISGIILRFHPRLASPAVLAYTLGLRHALDADHVSAID
LVTRRLIAAGQRPASVGCFFSLGHSTVVIITCVVVAATSGALRDRFDGFSRVGNIVGTSVSAAFLIILCLGNAWV
LYKLVKRLQQVLEHRRCRTVGGVEHAVAADEEDASPDALASGQFHLEGAGFLARVFKTLFKAIDRPWKMYPLGIV
FGLGFDTSSEIAILGIASIQAIKGTSIWLILIFPILFTSGMCLLDTVDGALMLALYTSKAFSRDIVAILYYSIVL
TAITIAVSAFIGIVQVLSLVQNVAHPQGSFWDGVSAIGDNFDIIGGSICGLFVLVGLGAAIVYKPWRRRVERDSS
RPLLAPPSEPCSPDHQGPVSPFADNTPSQTTGQDIV*
Coding >OphauB2|4027
ATGCCACGAAACCTCAACCTCCTTGTCGAAAAGCCCCGCCTTCTTCGCGGCATCCCCTCAAACAGCATCGCCATA
ATCACCCTCCTCATCACCACCAATCTCGCCACATGGGCCATTTCTGGCATCATTCTGCGCTTCCACCCCCGGCTC
GCCTCCCCCGCCGTACTCGCCTACACGCTTGGCCTCCGCCACGCCCTCGACGCAGACCACGTTTCTGCCATTGAC
CTTGTCACGCGCCGCCTCATTGCCGCGGGGCAGCGACCCGCCTCGGTGGGCTGCTTCTTCTCCCTCGGCCATAGC
ACCGTTGTTATAATCACCTGTGTCGTTGTGGCGGCCACGTCGGGTGCGCTGCGGGACCGCTTTGATGGCTTTAGT
CGCGTGGGCAACATTGTCGGCACGTCGGTCAGTGCGGCGTTTTTAATTATCTTGTGCTTGGGCAATGCTTGGGTG
CTGTATAAGCTGGTCAAGAGACTGCAGCAAGTCTTGGAGCATCGACGGTGCCGCACCGTAGGGGGGGTGGAACAT
GCTGTTGCTGCGGATGAGGAGGATGCGTCGCCTGATGCCCTGGCTAGCGGCCAGTTTCATCTCGAGGGCGCCGGG
TTTCTTGCCCGCGTCTTCAAGACGCTCTTCAAAGCCATTGATCGCCCCTGGAAAATGTATCCCCTCGGCATCGTC
TTTGGCCTTGGCTTCGACACCTCTTCAGAGATTGCCATTCTCGGCATTGCCAGCATACAAGCAATCAAGGGCACC
AGCATCTGGCTCATTCTCATCTTTCCCATCCTCTTTACATCGGGCATGTGTCTCCTCGACACCGTTGACGGCGCC
CTCATGCTTGCACTCTACACATCAAAGGCCTTTTCCCGTGACATTGTTGCCATTCTATACTACTCCATTGTACTC
ACCGCCATTACAATCGCCGTCTCCGCCTTTATCGGCATCGTCCAAGTCTTGTCCCTCGTGCAAAATGTCGCCCAT
CCACAGGGCAGCTTCTGGGACGGCGTGTCGGCCATTGGTGACAATTTTGACATTATTGGCGGCAGCATCTGTGGC
CTCTTTGTCCTCGTTGGTCTCGGTGCTGCCATTGTGTATAAGCCTTGGCGCCGGCGTGTCGAGCGCGACAGCTCT
AGACCGCTCTTGGCACCCCCTAGTGAACCTTGCTCTCCAGATCACCAGGGGCCTGTTTCGCCTTTTGCTGACAAT
ACACCTTCACAAACAACTGGGCAAGACATAGTTTAA
Transcript >OphauB2|4027
ATGCCACGAAACCTCAACCTCCTTGTCGAAAAGCCCCGCCTTCTTCGCGGCATCCCCTCAAACAGCATCGCCATA
ATCACCCTCCTCATCACCACCAATCTCGCCACATGGGCCATTTCTGGCATCATTCTGCGCTTCCACCCCCGGCTC
GCCTCCCCCGCCGTACTCGCCTACACGCTTGGCCTCCGCCACGCCCTCGACGCAGACCACGTTTCTGCCATTGAC
CTTGTCACGCGCCGCCTCATTGCCGCGGGGCAGCGACCCGCCTCGGTGGGCTGCTTCTTCTCCCTCGGCCATAGC
ACCGTTGTTATAATCACCTGTGTCGTTGTGGCGGCCACGTCGGGTGCGCTGCGGGACCGCTTTGATGGCTTTAGT
CGCGTGGGCAACATTGTCGGCACGTCGGTCAGTGCGGCGTTTTTAATTATCTTGTGCTTGGGCAATGCTTGGGTG
CTGTATAAGCTGGTCAAGAGACTGCAGCAAGTCTTGGAGCATCGACGGTGCCGCACCGTAGGGGGGGTGGAACAT
GCTGTTGCTGCGGATGAGGAGGATGCGTCGCCTGATGCCCTGGCTAGCGGCCAGTTTCATCTCGAGGGCGCCGGG
TTTCTTGCCCGCGTCTTCAAGACGCTCTTCAAAGCCATTGATCGCCCCTGGAAAATGTATCCCCTCGGCATCGTC
TTTGGCCTTGGCTTCGACACCTCTTCAGAGATTGCCATTCTCGGCATTGCCAGCATACAAGCAATCAAGGGCACC
AGCATCTGGCTCATTCTCATCTTTCCCATCCTCTTTACATCGGGCATGTGTCTCCTCGACACCGTTGACGGCGCC
CTCATGCTTGCACTCTACACATCAAAGGCCTTTTCCCGTGACATTGTTGCCATTCTATACTACTCCATTGTACTC
ACCGCCATTACAATCGCCGTCTCCGCCTTTATCGGCATCGTCCAAGTCTTGTCCCTCGTGCAAAATGTCGCCCAT
CCACAGGGCAGCTTCTGGGACGGCGTGTCGGCCATTGGTGACAATTTTGACATTATTGGCGGCAGCATCTGTGGC
CTCTTTGTCCTCGTTGGTCTCGGTGCTGCCATTGTGTATAAGCCTTGGCGCCGGCGTGTCGAGCGCGACAGCTCT
AGACCGCTCTTGGCACCCCCTAGTGAACCTTGCTCTCCAGATCACCAGGGGCCTGTTTCGCCTTTTGCTGACAAT
ACACCTTCACAAACAACTGGGCAAGACATAGTTTAA
Gene >OphauB2|4027
ATGCCACGAAACCTCAACCTCCTTGTCGAAAAGCCCCGCCTTCTTCGCGGCATCCCCTCAAACAGCATCGCCATA
ATCACCCTCCTCATCACCACCAATCTCGCCACATGGGCCATTTCTGGCATCATTCTGCGCTTCCACCCCCGGCTC
GCCTCCCCCGCCGTACTCGCCTACACGCTTGGCCTCCGCCACGCCCTCGACGCAGACCACGTTTCTGCCATTGAC
CTTGTCACGCGCCGCCTCATTGCCGCGGGGCAGCGACCCGCCTCGGTGGGCTGCTTCTTCTCCCTCGGCCATAGC
ACCGTTGTTATAATCACCTGTGTCGTTGTGGCGGCCACGTCGGGTGCGCTGCGGGACCGCTTTGATGGCTTTAGT
CGCGTGGGCAACATTGTCGGCACGTCGGTCAGTGCGGCGTTTTTAATTATCTTGTGCTTGGGCAATGCTTGGGTG
CTGTATAAGCTGGTCAAGAGACTGCAGCAAGTCTTGGAGCATCGACGGTGCCGCACCGTAGGGGGGGTGGAACAT
GCTGTTGCTGCGGATGAGGAGGATGCGTCGCCTGATGCCCTGGCTAGCGGCCAGTTTCATCTCGAGGGCGCCGGG
TTTCTTGCCCGCGTCTTCAAGACGCTCTTCAAAGCCATTGATCGCCCCTGGAAAATGTATCCCCTCGGCATCGTC
TTTGGCCTTGGCTTCGACACCTCTTCAGAGATTGCCATTCTCGGCATTGCCAGCATACAAGCAATCAAGGGCACC
AGCATCTGGCTCATTCTCATCTTTCCCATCCTCTTTACATGTAAGCCTCCTTGTCCATTCTTCTTTGCATTTTCT
TTGCTCTGCGCGACAAGACTTGTTTTCCCCTCGAATGGCTGACTTGAGCTGCCAAAAGCGGGCATGTGTCTCCTC
GACACCGTTGACGGCGCCCTCATGCTTGCACTCTACACATCAAAGGCCTTTTCCCGTGACATTGTTGCCATTCTA
TACTACTCCATTGTACTCACCGCCATTACAATCGCCGTCTCCGCCTTTATCGGCATCGTCCAAGTCTTGTCCCTC
GTGCAAAATGTCGCCCATCCACAGGGCAGCTTCTGGGACGGCGTGTCGGCCATTGGTGACAATTTTGACATTATT
GGCGGCAGCATCTGTGGCCTCTTTGTCCTCGTTGGTCTCGGTGCTGCCATTGTGTATAAGCCTTGGCGCCGGCGT
GTCGAGCGCGACAGCTCTAGACCGCTCTTGGCACCCCCTAGTGAACCTTGCTCTCCAGATCACCAGGGGCCTGTT
TCGCCTTTTGCTGACAATACACCTTCACAAACAACTGGGCAAGACATAGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail