Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4017
Gene name
LocationContig_26:94521..95669
Strand+
Gene length (bp)1148
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 2.6E-18 158 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 13 306 2.0E-34
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 19 306 2.0E-34
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 14 308 5.0E-28
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 14 296 1.0E-27
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 143 310 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 13 306 2.0E-34
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 19 306 2.0E-34
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 14 308 5.0E-28
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 14 296 1.0E-27
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 143 310 2.0E-17
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 160 298 5.0E-16
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 92 306 3.0E-15
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 160 298 3.0E-15
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 13 298 9.0E-14
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 160 298 2.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 160 319 1.0E-11
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 160 297 2.0E-10
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 157 304 3.0E-10
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 6 314 4.0E-10
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 160 307 6.0E-10
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 105 297 6.0E-10
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 147 319 2.0E-09
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 22 319 3.0E-09
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 160 320 4.0E-09
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 160 319 2.0E-08
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 160 319 2.0E-08
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 160 315 1.0E-07
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 160 319 2.0E-07
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 160 297 9.0E-07
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 121 298 1.0E-06
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 160 280 1.0E-06
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 160 319 2.0E-06
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 146 267 2.0E-06
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 117 304 2.0E-06
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 157 267 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4017
MASNEEGTHKALDLATALGVDADHLSRLMRHLGAMGFLIEVNENEYKGTNFTKALSMPVIGNSYIAMVSGTSAAT
IKFHEFSRQNEWQSPANRNYTSLMHTYNTDKDMFAWLVSLGYGTHFNDHMGGYNLGRIPWMDPAVFPVQERLIAG
ADTDPKAPFLVDIGGSIGHDLLKLRRYYPNTPGRLILQDLPAVTSQVKDLGPCIDIMSHDFNTDQPVKGARAYLI
HSCLHNWSDAACANILTRIKNAMTPGYSKLLICELVISNTNAHWEETGLDMIMMTLFATKERTADAWHQLVEEKV
GLKIVNIWTAGKGIESLIECEVA*
Coding >OphauB2|4017
ATGGCAAGCAATGAAGAGGGCACTCACAAGGCGCTCGATTTGGCTACGGCTCTCGGTGTTGACGCAGACCATCTC
AGTCGCTTGATGCGACATTTAGGCGCCATGGGATTCTTAATCGAGGTCAACGAAAACGAGTACAAAGGCACAAAC
TTCACCAAAGCCCTCAGCATGCCAGTCATTGGGAATAGCTACATTGCCATGGTCTCGGGTACCAGCGCCGCTACC
ATTAAATTTCACGAATTCTCGCGTCAAAATGAATGGCAAAGCCCCGCGAATAGAAATTACACATCTCTAATGCAC
ACTTATAACACGGATAAAGACATGTTTGCCTGGCTAGTGTCGCTGGGCTACGGCACTCATTTCAACGATCACATG
GGCGGCTATAACCTCGGCCGCATCCCGTGGATGGACCCAGCCGTATTTCCCGTCCAAGAGCGACTCATTGCTGGA
GCTGATACAGACCCAAAAGCACCTTTTCTCGTGGACATTGGTGGTAGTATTGGCCACGATCTTTTGAAACTGAGG
CGCTATTACCCAAACACCCCTGGAAGACTAATTCTTCAGGATCTACCCGCAGTAACAAGTCAGGTCAAAGACCTT
GGCCCCTGCATCGATATTATGAGCCACGACTTTAACACGGACCAGCCCGTCAAGGGTGCTCGCGCCTACCTCATT
CACTCTTGCCTACACAACTGGTCCGACGCTGCATGCGCAAACATTCTTACCCGGATAAAAAATGCCATGACACCT
GGCTACAGTAAACTACTTATATGTGAGCTCGTAATCTCAAACACTAATGCGCACTGGGAGGAAACCGGACTTGAC
ATGATTATGATGACGCTCTTTGCTACAAAGGAGCGGACTGCCGATGCCTGGCACCAATTGGTCGAAGAAAAGGTT
GGCCTAAAGATTGTCAATATCTGGACAGCCGGCAAGGGCATCGAAAGCCTGATTGAATGTGAAGTAGCTTGA
Transcript >OphauB2|4017
ATGGCAAGCAATGAAGAGGGCACTCACAAGGCGCTCGATTTGGCTACGGCTCTCGGTGTTGACGCAGACCATCTC
AGTCGCTTGATGCGACATTTAGGCGCCATGGGATTCTTAATCGAGGTCAACGAAAACGAGTACAAAGGCACAAAC
TTCACCAAAGCCCTCAGCATGCCAGTCATTGGGAATAGCTACATTGCCATGGTCTCGGGTACCAGCGCCGCTACC
ATTAAATTTCACGAATTCTCGCGTCAAAATGAATGGCAAAGCCCCGCGAATAGAAATTACACATCTCTAATGCAC
ACTTATAACACGGATAAAGACATGTTTGCCTGGCTAGTGTCGCTGGGCTACGGCACTCATTTCAACGATCACATG
GGCGGCTATAACCTCGGCCGCATCCCGTGGATGGACCCAGCCGTATTTCCCGTCCAAGAGCGACTCATTGCTGGA
GCTGATACAGACCCAAAAGCACCTTTTCTCGTGGACATTGGTGGTAGTATTGGCCACGATCTTTTGAAACTGAGG
CGCTATTACCCAAACACCCCTGGAAGACTAATTCTTCAGGATCTACCCGCAGTAACAAGTCAGGTCAAAGACCTT
GGCCCCTGCATCGATATTATGAGCCACGACTTTAACACGGACCAGCCCGTCAAGGGTGCTCGCGCCTACCTCATT
CACTCTTGCCTACACAACTGGTCCGACGCTGCATGCGCAAACATTCTTACCCGGATAAAAAATGCCATGACACCT
GGCTACAGTAAACTACTTATATGTGAGCTCGTAATCTCAAACACTAATGCGCACTGGGAGGAAACCGGACTTGAC
ATGATTATGATGACGCTCTTTGCTACAAAGGAGCGGACTGCCGATGCCTGGCACCAATTGGTCGAAGAAAAGGTT
GGCCTAAAGATTGTCAATATCTGGACAGCCGGCAAGGGCATCGAAAGCCTGATTGAATGTGAAGTAGCTTGA
Gene >OphauB2|4017
ATGGCAAGCAATGAAGAGGGCACTCACAAGGCGCTCGATTTGGCTACGGCTCTCGGTGTTGACGCAGACCATCTC
AGTGAGCCTCCTCTCCACTCGATTCGACAGTCTATTGGTCAAGAGGGCTAACCTGACGATATTCTAGGTCGCTTG
ATGCGACATTTAGGCGCCATGGGATTCTTAATCGAGGTCAACGAAAACGAGTACAAAGGCACAAACTTCACCAAA
GCCCTCAGCATGCCAGTCATTGGGAATAGCTACATTGCCATGTAGGCTCTACACTACACACTCCTACCACAACCC
TCACGAGTCGCTAATCGTCCCTAGGGTCTCGGGTACCAGCGCCGCTACCATTAAATTTCACGAATTCTCGCGTCA
AAATGAATGGCAAAGCCCCGCGAATAGAAATTACACATCTCTAATGCACACTTATAACACGGATAAAGACATGTT
TGCCTGGCTAGTGTCGCTGGGCTACGGCACTCATTTCAACGATCACATGGGCGGCTATAACCTCGGCCGCATCCC
GTGGATGGACCCAGCCGTATTTCCCGTCCAAGAGCGACTCATTGCTGGAGCTGATACAGACCCAAAAGCACCTTT
TCTCGTGGACATTGGTGGTAGTATTGGCCACGATCTTTTGAAACTGAGGCGCTATTACCCAAACACCCCTGGAAG
ACTAATTCTTCAGGATCTACCCGCAGTAACAAGTCAGGTCAAAGACCTTGGCCCCTGCATCGATATTATGAGCCA
CGACTTTAACACGGACCAGCCCGTCAAGGGTAAATGATCATTTTCTTTTAATACTTTATACAATGGTCTAACACT
CTTTAGGTGCTCGCGCCTACCTCATTCACTCTTGCCTACACAACTGGTCCGACGCTGCATGCGCAAACATTCTTA
CCCGGATAAAAAATGCCATGACACCTGGCTACAGTAAACTACTTATATGTGAGCTCGTAATCTCAAACACTAATG
CGCACTGGGAGGAAACCGGACTTGACATGATTATGATGACGCTCTTTGCTACAAAGGAGCGGACTGCCGATGCCT
GGCACCAATTGGTCGAAGAAAAGGTTGGCCTAAAGATTGTCAATATCTGGACAGCCGGCAAGGGCATCGAAAGCC
TGATTGAATGTGAAGTAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail