Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4012
Gene name
LocationContig_26:80765..81849
Strand-
Gene length (bp)1084
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 6.0E-08 28 103

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999781

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7153
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1534
Ophiocordyceps australis map64 (Brazil) OphauB2|4012 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9606

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4012
MATFFLLAIFGFLSVLAQTNHVTPSFTYVGCSQVDLSCFGSPAVIPDGRITPEACQVACKGHHYAALFPDACRCG
DDVKAVKPVDESVCNYPCMGDGNLGMCGSVCPAEGPGIANVYGCSSSQVNAPQPVTLKTTVTLQSPTPTIDTTCS
DKQQSLVTQSAVSVVNTQGSSPESAITVVSYLSPHGSAPEIPTFAPTEQTVVSGASSTCHDENKTTQPVSKLSTL
PTIATTSIPEMPAYGSTDSPPLYATQESQSLSYITISYTVELGTDEASAETSSSVANCTSSDASITSETLWEPNT
SVPDMPSESLRVPSRVPGSDSSHSFVPPVVKLGALAMVAVMVM*
Coding >OphauB2|4012
ATGGCGACGTTCTTTCTGCTGGCCATCTTTGGCTTTCTCAGCGTCTTGGCTCAAACCAACCACGTTACCCCATCA
TTCACTTATGTTGGCTGTTCCCAAGTCGACCTGTCGTGTTTTGGTAGCCCAGCTGTCATTCCGGACGGCCGAATC
ACGCCCGAGGCCTGCCAGGTTGCTTGCAAAGGGCATCATTATGCCGCTCTTTTCCCCGATGCTTGCCGCTGCGGC
GACGACGTGAAGGCCGTCAAGCCTGTCGATGAAAGTGTATGCAACTATCCATGCATGGGGGATGGCAATCTCGGC
ATGTGTGGCAGCGTTTGCCCGGCTGAGGGTCCTGGTATTGCCAATGTCTATGGCTGCTCTAGCTCGCAAGTCAAT
GCTCCTCAGCCAGTGACTCTGAAGACGACGGTCACGCTGCAGTCCCCGACTCCCACGATTGACACGACTTGTTCG
GATAAGCAACAGTCTCTTGTGACTCAATCTGCAGTTTCTGTGGTGAATACCCAGGGTTCGTCGCCCGAATCTGCT
ATAACAGTCGTCTCTTACCTGTCGCCGCATGGCTCTGCACCTGAAATTCCAACTTTTGCACCCACTGAGCAGACA
GTAGTGTCTGGTGCGTCTTCTACCTGCCATGACGAAAACAAGACGACGCAGCCGGTTTCGAAACTTTCCACTTTG
CCTACGATTGCGACCACTAGCATTCCGGAAATGCCGGCATATGGCAGCACTGACTCTCCTCCGCTATATGCCACT
CAAGAATCCCAATCGCTGTCGTATATCACCATCAGCTATACTGTTGAATTGGGGACGGACGAAGCGTCTGCTGAA
ACATCCTCATCGGTGGCAAATTGCACTTCCTCTGACGCGTCAATCACTTCTGAGACGCTATGGGAACCCAACACA
TCGGTGCCCGATATGCCTTCAGAGTCTCTGCGCGTGCCTTCGCGAGTGCCGGGGTCGGATTCCTCTCACAGCTTT
GTGCCGCCGGTGGTGAAGCTTGGCGCGCTGGCCATGGTGGCAGTCATGGTTATGTGA
Transcript >OphauB2|4012
ATGGCGACGTTCTTTCTGCTGGCCATCTTTGGCTTTCTCAGCGTCTTGGCTCAAACCAACCACGTTACCCCATCA
TTCACTTATGTTGGCTGTTCCCAAGTCGACCTGTCGTGTTTTGGTAGCCCAGCTGTCATTCCGGACGGCCGAATC
ACGCCCGAGGCCTGCCAGGTTGCTTGCAAAGGGCATCATTATGCCGCTCTTTTCCCCGATGCTTGCCGCTGCGGC
GACGACGTGAAGGCCGTCAAGCCTGTCGATGAAAGTGTATGCAACTATCCATGCATGGGGGATGGCAATCTCGGC
ATGTGTGGCAGCGTTTGCCCGGCTGAGGGTCCTGGTATTGCCAATGTCTATGGCTGCTCTAGCTCGCAAGTCAAT
GCTCCTCAGCCAGTGACTCTGAAGACGACGGTCACGCTGCAGTCCCCGACTCCCACGATTGACACGACTTGTTCG
GATAAGCAACAGTCTCTTGTGACTCAATCTGCAGTTTCTGTGGTGAATACCCAGGGTTCGTCGCCCGAATCTGCT
ATAACAGTCGTCTCTTACCTGTCGCCGCATGGCTCTGCACCTGAAATTCCAACTTTTGCACCCACTGAGCAGACA
GTAGTGTCTGGTGCGTCTTCTACCTGCCATGACGAAAACAAGACGACGCAGCCGGTTTCGAAACTTTCCACTTTG
CCTACGATTGCGACCACTAGCATTCCGGAAATGCCGGCATATGGCAGCACTGACTCTCCTCCGCTATATGCCACT
CAAGAATCCCAATCGCTGTCGTATATCACCATCAGCTATACTGTTGAATTGGGGACGGACGAAGCGTCTGCTGAA
ACATCCTCATCGGTGGCAAATTGCACTTCCTCTGACGCGTCAATCACTTCTGAGACGCTATGGGAACCCAACACA
TCGGTGCCCGATATGCCTTCAGAGTCTCTGCGCGTGCCTTCGCGAGTGCCGGGGTCGGATTCCTCTCACAGCTTT
GTGCCGCCGGTGGTGAAGCTTGGCGCGCTGGCCATGGTGGCAGTCATGGTTATGTGA
Gene >OphauB2|4012
ATGGCGACGTTCTTTCTGCTGGCCATCTTTGGCTTTCTCAGCGTCTTGGCTCAAACCAACCACGTTACCCCATCA
TTCACTTATGTTGGCTGTTCCCAAGTCGACCTGTCGTGTTTTGGTAGCCCAGCTGTCATTCCGGACGGCCGAATC
ACGCCCGAGGCCTGCCAGGTTGCTTGCAAAGGGCATCATTATGCCGCTCTTTTCCCCGAGTATGATCTCACACCC
GGCCCTGCTCGCTTTGACCCGTCTAACCTGGTAAAGTGCTTGCCGCTGCGGCGACGACGTGAAGGCCGTCAAGCC
TGTCGATGAAAGTGTATGCAACTATCCATGCATGGGGGATGGCAATCTCGGCATGTGTGGCAGCGTTTGCCCGGC
TGAGGGTCCTGGTATTGCCAATGTCTATGGCTGCTCTAGCTCGCAAGTCAATGCTCCTCAGCCAGTGACTCTGAA
GACGACGGTCACGCTGCAGTCCCCGACTCCCACGATTGACACGACTTGTTCGGATAAGCAACAGTCTCTTGTGAC
TCAATCTGCAGTTTCTGTGGTGAATACCCAGGGTTCGTCGCCCGAATCTGCTATAACAGTCGTCTCTTACCTGTC
GCCGCATGGCTCTGCACCTGAAATTCCAACTTTTGCACCCACTGAGCAGACAGTAGTGTCTGGTGCGTCTTCTAC
CTGCCATGACGAAAACAAGACGACGCAGCCGGTTTCGAAACTTTCCACTTTGCCTACGATTGCGACCACTAGCAT
TCCGGAAATGCCGGCATATGGCAGCACTGACTCTCCTCCGCTATATGCCACTCAAGAATCCCAATCGCTGTCGTA
TATCACCATCAGCTATACTGTTGAATTGGGGACGGACGAAGCGTCTGCTGAAACATCCTCATCGGTGGCAAATTG
CACTTCCTCTGACGCGTCAATCACTTCTGAGACGCTATGGGAACCCAACACATCGGTGCCCGATATGCCTTCAGA
GTCTCTGCGCGTGCCTTCGCGAGTGCCGGGGTCGGATTCCTCTCACAGCTTTGTGCCGCCGGTGGTGAAGCTTGG
CGCGCTGGCCATGGTGGCAGTCATGGTTATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail