Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4009
Gene name
LocationContig_26:74479..75588
Strand-
Gene length (bp)1109
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 1.2E-11 12 132
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 8.1E-18 185 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q869T1|TWF_DICDI Twinfilin OS=Dictyostelium discoideum GN=twfA PE=1 SV=1 3 332 4.0E-41
sp|Q6IBS0|TWF2_HUMAN Twinfilin-2 OS=Homo sapiens GN=TWF2 PE=1 SV=2 2 331 1.0E-36
sp|Q9Z0P5|TWF2_MOUSE Twinfilin-2 OS=Mus musculus GN=Twf2 PE=1 SV=1 2 331 2.0E-36
sp|Q5ZM35|TWF2_CHICK Twinfilin-2 OS=Gallus gallus GN=TWF2 PE=1 SV=1 2 330 3.0E-36
sp|Q12792|TWF1_HUMAN Twinfilin-1 OS=Homo sapiens GN=TWF1 PE=1 SV=3 2 331 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q869T1|TWF_DICDI Twinfilin OS=Dictyostelium discoideum GN=twfA PE=1 SV=1 3 332 4.0E-41
sp|Q6IBS0|TWF2_HUMAN Twinfilin-2 OS=Homo sapiens GN=TWF2 PE=1 SV=2 2 331 1.0E-36
sp|Q9Z0P5|TWF2_MOUSE Twinfilin-2 OS=Mus musculus GN=Twf2 PE=1 SV=1 2 331 2.0E-36
sp|Q5ZM35|TWF2_CHICK Twinfilin-2 OS=Gallus gallus GN=TWF2 PE=1 SV=1 2 330 3.0E-36
sp|Q12792|TWF1_HUMAN Twinfilin-1 OS=Homo sapiens GN=TWF1 PE=1 SV=3 2 331 4.0E-35
sp|Q91YR1|TWF1_MOUSE Twinfilin-1 OS=Mus musculus GN=Twf1 PE=1 SV=2 2 331 4.0E-35
sp|Q5RJR2|TWF1_RAT Twinfilin-1 OS=Rattus norvegicus GN=Twf1 PE=1 SV=1 2 331 6.0E-34
sp|Q5R7N2|TWF1_PONAB Twinfilin-1 OS=Pongo abelii GN=TWF1 PE=2 SV=1 2 330 6.0E-34
sp|Q5I082|TWF1_XENTR Twinfilin-1 OS=Xenopus tropicalis GN=twf1 PE=2 SV=1 2 331 5.0E-33
sp|Q7ZXP0|TWF2A_XENLA Twinfilin-2-A OS=Xenopus laevis GN=twf2-a PE=2 SV=1 2 330 5.0E-33
sp|Q6GMH3|TWF2_DANRE Twinfilin-2 OS=Danio rerio GN=twf2 PE=2 SV=1 69 330 9.0E-33
sp|Q56JV6|TWF1_BOVIN Twinfilin-1 OS=Bos taurus GN=TWF1 PE=2 SV=1 2 330 9.0E-33
sp|Q5RFH1|TWF2_PONAB Twinfilin-2 (Fragment) OS=Pongo abelii GN=TWF2 PE=3 SV=1 7 331 2.0E-32
sp|Q68F50|TWF1_XENLA Twinfilin-1 OS=Xenopus laevis GN=twf1 PE=2 SV=1 2 331 4.0E-32
sp|Q640W2|TWF2B_XENLA Twinfilin-2-B OS=Xenopus laevis GN=twf2-b PE=2 SV=1 2 330 7.0E-32
sp|Q9VFM9|TWF_DROME Twinfilin OS=Drosophila melanogaster GN=twf PE=1 SV=1 2 330 3.0E-31
sp|Q17A58|TWF_AEDAE Twinfilin OS=Aedes aegypti GN=twf PE=3 SV=1 2 330 3.0E-30
sp|Q7QG28|TWF_ANOGA Twinfilin OS=Anopheles gambiae GN=twf PE=3 SV=2 2 330 4.0E-30
sp|Q298X4|TWF_DROPS Twinfilin OS=Drosophila pseudoobscura pseudoobscura GN=twf PE=3 SV=2 2 330 9.0E-30
sp|O94399|TWF1_SCHPO Twinfilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=twf1 PE=1 SV=1 5 325 2.0E-21
sp|P53250|TWF1_YEAST Twinfilin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TWF1 PE=1 SV=1 2 332 4.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4578
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2673
Ophiocordyceps australis map64 (Brazil) OphauB2|4009 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07029
Ophiocordyceps camponoti-rufipedis Ophun1|4589
Ophiocordyceps kimflemingae Ophio5|6703
Ophiocordyceps subramaniannii Hirsu2|9605

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4009
MQSGISASHELQAKFNSMLASADTFALIVKIERESLVPATEIASKSSSFGENLSSLQSCIKPNEALYVILRRYDE
APQFLAVTYVPDLAPVRQKTLVASTRLTLVRELGTEHFRETVFLTMADELSENGFKKLDAHNKLAAPLTEEEKTL
DEVKKAEQEAGAGTGTREIHLSKSLAMPVAEDAIAAMKELGQDGERLVTMLKINPETEVVELVPESPRPHSIGEL
SKAISSTEPRFTLFRFTHTHDGAEQSPLLFFYTCPLTAGNKAIRNRMLYPLMKRAVLEIAKSEAGLELEKRFEVE
EPSEITEQLVMDDLHPKAATRQGFSRPKRPGR*
Coding >OphauB2|4009
ATGCAGTCTGGAATCTCTGCATCGCACGAGCTTCAGGCCAAGTTCAACTCAATGCTGGCATCGGCCGACACATTT
GCCCTAATCGTCAAGATTGAACGCGAGAGCTTGGTGCCGGCAACAGAGATAGCTTCCAAGTCGTCTTCCTTTGGC
GAGAACCTGTCTAGTTTGCAATCATGCATCAAGCCCAACGAAGCACTATATGTCATCTTGAGACGGTATGACGAA
GCGCCGCAATTTCTTGCCGTAACGTACGTGCCCGACCTGGCGCCGGTGCGTCAAAAGACTCTGGTCGCATCTACG
CGCTTGACGCTGGTACGGGAGCTGGGAACAGAACACTTTCGCGAAACAGTCTTCTTGACCATGGCGGACGAGCTG
AGCGAGAACGGCTTTAAGAAGCTGGATGCGCACAACAAGCTGGCAGCTCCGCTGACAGAAGAGGAAAAGACGTTG
GACGAAGTCAAAAAGGCGGAACAAGAGGCTGGTGCCGGTACTGGCACGAGGGAGATTCACCTGAGCAAGAGCCTG
GCCATGCCTGTTGCTGAGGATGCCATTGCAGCCATGAAGGAGCTTGGCCAGGACGGCGAACGACTGGTGACAATG
CTGAAAATCAACCCCGAGACTGAGGTTGTCGAACTGGTGCCCGAGTCGCCACGGCCGCATTCAATTGGAGAGCTC
TCCAAGGCTATTTCGTCCACGGAGCCGCGATTTACGCTTTTCCGCTTCACGCACACGCACGACGGTGCCGAACAG
AGCCCACTGCTCTTCTTTTACACTTGTCCATTGACGGCTGGCAACAAGGCCATTAGAAACCGCATGCTTTATCCA
CTCATGAAGCGTGCAGTGCTGGAGATTGCCAAGTCTGAGGCTGGACTGGAGCTGGAAAAGAGATTTGAAGTGGAA
GAGCCAAGCGAGATTACGGAACAATTGGTCATGGACGATTTGCATCCCAAGGCGGCCACCAGGCAAGGCTTTAGC
AGACCAAAGCGTCCTGGGCGGTGA
Transcript >OphauB2|4009
ATGCAGTCTGGAATCTCTGCATCGCACGAGCTTCAGGCCAAGTTCAACTCAATGCTGGCATCGGCCGACACATTT
GCCCTAATCGTCAAGATTGAACGCGAGAGCTTGGTGCCGGCAACAGAGATAGCTTCCAAGTCGTCTTCCTTTGGC
GAGAACCTGTCTAGTTTGCAATCATGCATCAAGCCCAACGAAGCACTATATGTCATCTTGAGACGGTATGACGAA
GCGCCGCAATTTCTTGCCGTAACGTACGTGCCCGACCTGGCGCCGGTGCGTCAAAAGACTCTGGTCGCATCTACG
CGCTTGACGCTGGTACGGGAGCTGGGAACAGAACACTTTCGCGAAACAGTCTTCTTGACCATGGCGGACGAGCTG
AGCGAGAACGGCTTTAAGAAGCTGGATGCGCACAACAAGCTGGCAGCTCCGCTGACAGAAGAGGAAAAGACGTTG
GACGAAGTCAAAAAGGCGGAACAAGAGGCTGGTGCCGGTACTGGCACGAGGGAGATTCACCTGAGCAAGAGCCTG
GCCATGCCTGTTGCTGAGGATGCCATTGCAGCCATGAAGGAGCTTGGCCAGGACGGCGAACGACTGGTGACAATG
CTGAAAATCAACCCCGAGACTGAGGTTGTCGAACTGGTGCCCGAGTCGCCACGGCCGCATTCAATTGGAGAGCTC
TCCAAGGCTATTTCGTCCACGGAGCCGCGATTTACGCTTTTCCGCTTCACGCACACGCACGACGGTGCCGAACAG
AGCCCACTGCTCTTCTTTTACACTTGTCCATTGACGGCTGGCAACAAGGCCATTAGAAACCGCATGCTTTATCCA
CTCATGAAGCGTGCAGTGCTGGAGATTGCCAAGTCTGAGGCTGGACTGGAGCTGGAAAAGAGATTTGAAGTGGAA
GAGCCAAGCGAGATTACGGAACAATTGGTCATGGACGATTTGCATCCCAAGGCGGCCACCAGGCAAGGCTTTAGC
AGACCAAAGCGTCCTGGGCGGTGA
Gene >OphauB2|4009
ATGCAGTCTGGAATCTCTGGTATTTTCATCGATATTAGTGCTCCATGGAACTAGAGCTAATCCGATTCTTGATAG
CATCGCACGAGCTTCAGGCCAAGTTCAACTCAATGCTGGCATCGGCCGACACATTTGCCCTAATCGTCAAGATTG
AACGCGAGAGCTTGGTGCCGGCAACAGAGATAGCTTCCAAGTCGTCTTCCTTTGGCGAGAACCTGTCTAGTTTGC
AATCATGCATCAAGCCCAACGAAGCACTATATGTCATCTTGAGACGGTATGACGAAGCGCCGCAATTTCTTGCCG
TAACGTACGTGCCCGACCTGGCGCCGGTGCGTCAAAAGACTCTGGTCGCATCTACGCGCTTGACGCTGGTACGGG
AGCTGGGAACAGAACACTTTCGCGAAACAGTCTTCTTGACCATGGCGGACGAGCTGAGCGAGAACGGCTTTAAGA
AGCTGGATGCGCACAACAAGCTGGCAGCTCCGCTGACAGAAGAGGAAAAGACGTTGGACGAAGTCAAAAAGGCGG
AACAAGAGGCTGGTGCCGGTACTGGCACGAGGGAGATTCACCTGAGCAAGAGCCTGGCCATGCCTGTTGCTGAGG
ATGCCATTGCAGCCATGAAGGAGCTTGGCCAGGACGGCGAACGACTGGTGACAATGCTGGTAATACTGCGGACAG
GAATACTTGAGCAAGGCAAGAGGCTGACTTTGGCGCAGAAAATCAACCCCGAGACTGAGGTTGTCGAACTGGTGC
CCGAGTCGCCACGGCCGCATTCAATTGGAGAGCTCTCCAAGGCTATTTCGTCCACGGAGCCGCGATTTACGCTTT
TCCGCTTCACGCACACGCACGACGGTGCCGAACAGAGCCCACTGCTCTTCTTTTACACTTGTCCATTGACGGCTG
GCAACAAGGCCATTAGAAACCGCATGCTTTATCCACTCATGAAGCGTGCAGTGCTGGAGATTGCCAAGTCTGAGG
CTGGACTGGAGCTGGAAAAGAGATTTGAAGTGGAAGAGCCAAGCGAGATTACGGAACAATTGGTCATGGACGATT
TGCATCCCAAGGCGGCCACCAGGCAAGGCTTTAGCAGACCAAAGCGTCCTGGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail