Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4009
Gene name
LocationContig_26:74479..75588
Strand-
Gene length (bp)1109
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 1.2E-11 12 132
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 8.1E-18 185 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q869T1|TWF_DICDI Twinfilin OS=Dictyostelium discoideum GN=twfA PE=1 SV=1 3 332 4.0E-41
sp|Q6IBS0|TWF2_HUMAN Twinfilin-2 OS=Homo sapiens GN=TWF2 PE=1 SV=2 2 331 1.0E-36
sp|Q9Z0P5|TWF2_MOUSE Twinfilin-2 OS=Mus musculus GN=Twf2 PE=1 SV=1 2 331 2.0E-36
sp|Q5ZM35|TWF2_CHICK Twinfilin-2 OS=Gallus gallus GN=TWF2 PE=1 SV=1 2 330 3.0E-36
sp|Q12792|TWF1_HUMAN Twinfilin-1 OS=Homo sapiens GN=TWF1 PE=1 SV=3 2 331 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q869T1|TWF_DICDI Twinfilin OS=Dictyostelium discoideum GN=twfA PE=1 SV=1 3 332 4.0E-41
sp|Q6IBS0|TWF2_HUMAN Twinfilin-2 OS=Homo sapiens GN=TWF2 PE=1 SV=2 2 331 1.0E-36
sp|Q9Z0P5|TWF2_MOUSE Twinfilin-2 OS=Mus musculus GN=Twf2 PE=1 SV=1 2 331 2.0E-36
sp|Q5ZM35|TWF2_CHICK Twinfilin-2 OS=Gallus gallus GN=TWF2 PE=1 SV=1 2 330 3.0E-36
sp|Q12792|TWF1_HUMAN Twinfilin-1 OS=Homo sapiens GN=TWF1 PE=1 SV=3 2 331 4.0E-35
sp|Q91YR1|TWF1_MOUSE Twinfilin-1 OS=Mus musculus GN=Twf1 PE=1 SV=2 2 331 4.0E-35
sp|Q5RJR2|TWF1_RAT Twinfilin-1 OS=Rattus norvegicus GN=Twf1 PE=1 SV=1 2 331 6.0E-34
sp|Q5R7N2|TWF1_PONAB Twinfilin-1 OS=Pongo abelii GN=TWF1 PE=2 SV=1 2 330 6.0E-34
sp|Q5I082|TWF1_XENTR Twinfilin-1 OS=Xenopus tropicalis GN=twf1 PE=2 SV=1 2 331 5.0E-33
sp|Q7ZXP0|TWF2A_XENLA Twinfilin-2-A OS=Xenopus laevis GN=twf2-a PE=2 SV=1 2 330 5.0E-33
sp|Q6GMH3|TWF2_DANRE Twinfilin-2 OS=Danio rerio GN=twf2 PE=2 SV=1 69 330 9.0E-33
sp|Q56JV6|TWF1_BOVIN Twinfilin-1 OS=Bos taurus GN=TWF1 PE=2 SV=1 2 330 9.0E-33
sp|Q5RFH1|TWF2_PONAB Twinfilin-2 (Fragment) OS=Pongo abelii GN=TWF2 PE=3 SV=1 7 331 2.0E-32
sp|Q68F50|TWF1_XENLA Twinfilin-1 OS=Xenopus laevis GN=twf1 PE=2 SV=1 2 331 4.0E-32
sp|Q640W2|TWF2B_XENLA Twinfilin-2-B OS=Xenopus laevis GN=twf2-b PE=2 SV=1 2 330 7.0E-32
sp|Q9VFM9|TWF_DROME Twinfilin OS=Drosophila melanogaster GN=twf PE=1 SV=1 2 330 3.0E-31
sp|Q17A58|TWF_AEDAE Twinfilin OS=Aedes aegypti GN=twf PE=3 SV=1 2 330 3.0E-30
sp|Q7QG28|TWF_ANOGA Twinfilin OS=Anopheles gambiae GN=twf PE=3 SV=2 2 330 4.0E-30
sp|Q298X4|TWF_DROPS Twinfilin OS=Drosophila pseudoobscura pseudoobscura GN=twf PE=3 SV=2 2 330 9.0E-30
sp|O94399|TWF1_SCHPO Twinfilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=twf1 PE=1 SV=1 5 325 2.0E-21
sp|P53250|TWF1_YEAST Twinfilin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TWF1 PE=1 SV=1 2 332 4.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4009
MQSGISASHELQAKFNSMLASADTFALIVKIERESLVPATEIASKSSSFGENLSSLQSCIKPNEALYVILRRYDE
APQFLAVTYVPDLAPVRQKTLVASTRLTLVRELGTEHFRETVFLTMADELSENGFKKLDAHNKLAAPLTEEEKTL
DEVKKAEQEAGAGTGTREIHLSKSLAMPVAEDAIAAMKELGQDGERLVTMLKINPETEVVELVPESPRPHSIGEL
SKAISSTEPRFTLFRFTHTHDGAEQSPLLFFYTCPLTAGNKAIRNRMLYPLMKRAVLEIAKSEAGLELEKRFEVE
EPSEITEQLVMDDLHPKAATRQGFSRPKRPGR*
Coding >OphauB2|4009
ATGCAGTCTGGAATCTCTGCATCGCACGAGCTTCAGGCCAAGTTCAACTCAATGCTGGCATCGGCCGACACATTT
GCCCTAATCGTCAAGATTGAACGCGAGAGCTTGGTGCCGGCAACAGAGATAGCTTCCAAGTCGTCTTCCTTTGGC
GAGAACCTGTCTAGTTTGCAATCATGCATCAAGCCCAACGAAGCACTATATGTCATCTTGAGACGGTATGACGAA
GCGCCGCAATTTCTTGCCGTAACGTACGTGCCCGACCTGGCGCCGGTGCGTCAAAAGACTCTGGTCGCATCTACG
CGCTTGACGCTGGTACGGGAGCTGGGAACAGAACACTTTCGCGAAACAGTCTTCTTGACCATGGCGGACGAGCTG
AGCGAGAACGGCTTTAAGAAGCTGGATGCGCACAACAAGCTGGCAGCTCCGCTGACAGAAGAGGAAAAGACGTTG
GACGAAGTCAAAAAGGCGGAACAAGAGGCTGGTGCCGGTACTGGCACGAGGGAGATTCACCTGAGCAAGAGCCTG
GCCATGCCTGTTGCTGAGGATGCCATTGCAGCCATGAAGGAGCTTGGCCAGGACGGCGAACGACTGGTGACAATG
CTGAAAATCAACCCCGAGACTGAGGTTGTCGAACTGGTGCCCGAGTCGCCACGGCCGCATTCAATTGGAGAGCTC
TCCAAGGCTATTTCGTCCACGGAGCCGCGATTTACGCTTTTCCGCTTCACGCACACGCACGACGGTGCCGAACAG
AGCCCACTGCTCTTCTTTTACACTTGTCCATTGACGGCTGGCAACAAGGCCATTAGAAACCGCATGCTTTATCCA
CTCATGAAGCGTGCAGTGCTGGAGATTGCCAAGTCTGAGGCTGGACTGGAGCTGGAAAAGAGATTTGAAGTGGAA
GAGCCAAGCGAGATTACGGAACAATTGGTCATGGACGATTTGCATCCCAAGGCGGCCACCAGGCAAGGCTTTAGC
AGACCAAAGCGTCCTGGGCGGTGA
Transcript >OphauB2|4009
ATGCAGTCTGGAATCTCTGCATCGCACGAGCTTCAGGCCAAGTTCAACTCAATGCTGGCATCGGCCGACACATTT
GCCCTAATCGTCAAGATTGAACGCGAGAGCTTGGTGCCGGCAACAGAGATAGCTTCCAAGTCGTCTTCCTTTGGC
GAGAACCTGTCTAGTTTGCAATCATGCATCAAGCCCAACGAAGCACTATATGTCATCTTGAGACGGTATGACGAA
GCGCCGCAATTTCTTGCCGTAACGTACGTGCCCGACCTGGCGCCGGTGCGTCAAAAGACTCTGGTCGCATCTACG
CGCTTGACGCTGGTACGGGAGCTGGGAACAGAACACTTTCGCGAAACAGTCTTCTTGACCATGGCGGACGAGCTG
AGCGAGAACGGCTTTAAGAAGCTGGATGCGCACAACAAGCTGGCAGCTCCGCTGACAGAAGAGGAAAAGACGTTG
GACGAAGTCAAAAAGGCGGAACAAGAGGCTGGTGCCGGTACTGGCACGAGGGAGATTCACCTGAGCAAGAGCCTG
GCCATGCCTGTTGCTGAGGATGCCATTGCAGCCATGAAGGAGCTTGGCCAGGACGGCGAACGACTGGTGACAATG
CTGAAAATCAACCCCGAGACTGAGGTTGTCGAACTGGTGCCCGAGTCGCCACGGCCGCATTCAATTGGAGAGCTC
TCCAAGGCTATTTCGTCCACGGAGCCGCGATTTACGCTTTTCCGCTTCACGCACACGCACGACGGTGCCGAACAG
AGCCCACTGCTCTTCTTTTACACTTGTCCATTGACGGCTGGCAACAAGGCCATTAGAAACCGCATGCTTTATCCA
CTCATGAAGCGTGCAGTGCTGGAGATTGCCAAGTCTGAGGCTGGACTGGAGCTGGAAAAGAGATTTGAAGTGGAA
GAGCCAAGCGAGATTACGGAACAATTGGTCATGGACGATTTGCATCCCAAGGCGGCCACCAGGCAAGGCTTTAGC
AGACCAAAGCGTCCTGGGCGGTGA
Gene >OphauB2|4009
ATGCAGTCTGGAATCTCTGGTATTTTCATCGATATTAGTGCTCCATGGAACTAGAGCTAATCCGATTCTTGATAG
CATCGCACGAGCTTCAGGCCAAGTTCAACTCAATGCTGGCATCGGCCGACACATTTGCCCTAATCGTCAAGATTG
AACGCGAGAGCTTGGTGCCGGCAACAGAGATAGCTTCCAAGTCGTCTTCCTTTGGCGAGAACCTGTCTAGTTTGC
AATCATGCATCAAGCCCAACGAAGCACTATATGTCATCTTGAGACGGTATGACGAAGCGCCGCAATTTCTTGCCG
TAACGTACGTGCCCGACCTGGCGCCGGTGCGTCAAAAGACTCTGGTCGCATCTACGCGCTTGACGCTGGTACGGG
AGCTGGGAACAGAACACTTTCGCGAAACAGTCTTCTTGACCATGGCGGACGAGCTGAGCGAGAACGGCTTTAAGA
AGCTGGATGCGCACAACAAGCTGGCAGCTCCGCTGACAGAAGAGGAAAAGACGTTGGACGAAGTCAAAAAGGCGG
AACAAGAGGCTGGTGCCGGTACTGGCACGAGGGAGATTCACCTGAGCAAGAGCCTGGCCATGCCTGTTGCTGAGG
ATGCCATTGCAGCCATGAAGGAGCTTGGCCAGGACGGCGAACGACTGGTGACAATGCTGGTAATACTGCGGACAG
GAATACTTGAGCAAGGCAAGAGGCTGACTTTGGCGCAGAAAATCAACCCCGAGACTGAGGTTGTCGAACTGGTGC
CCGAGTCGCCACGGCCGCATTCAATTGGAGAGCTCTCCAAGGCTATTTCGTCCACGGAGCCGCGATTTACGCTTT
TCCGCTTCACGCACACGCACGACGGTGCCGAACAGAGCCCACTGCTCTTCTTTTACACTTGTCCATTGACGGCTG
GCAACAAGGCCATTAGAAACCGCATGCTTTATCCACTCATGAAGCGTGCAGTGCTGGAGATTGCCAAGTCTGAGG
CTGGACTGGAGCTGGAAAAGAGATTTGAAGTGGAAGAGCCAAGCGAGATTACGGAACAATTGGTCATGGACGATT
TGCATCCCAAGGCGGCCACCAGGCAAGGCTTTAGCAGACCAAAGCGTCCTGGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail