Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4003
Gene name
LocationContig_26:60972..62229
Strand-
Gene length (bp)1257
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00465 Fe-ADH Iron-containing alcohol dehydrogenase 3.0E-56 39 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q45072|TFTE_BURCE Maleylacetate reductase OS=Burkholderia cepacia GN=tftE PE=3 SV=1 45 370 7.0E-14
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 45 389 1.0E-12
sp|A6ZTT5|ADH4_YEAS7 Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=ADH4 PE=3 SV=2 105 412 2.0E-12
sp|P10127|ADH4_YEAST Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH4 PE=1 SV=3 105 412 2.0E-12
sp|P37686|ADH2_ECOLI Probable alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=yiaY PE=3 SV=4 103 411 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q45072|TFTE_BURCE Maleylacetate reductase OS=Burkholderia cepacia GN=tftE PE=3 SV=1 45 370 7.0E-14
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 45 389 1.0E-12
sp|A6ZTT5|ADH4_YEAS7 Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=ADH4 PE=3 SV=2 105 412 2.0E-12
sp|P10127|ADH4_YEAST Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH4 PE=1 SV=3 105 412 2.0E-12
sp|P37686|ADH2_ECOLI Probable alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=yiaY PE=3 SV=4 103 411 2.0E-11
sp|Q09669|ADH4_SCHPO Alcohol dehydrogenase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh4 PE=2 SV=1 93 411 3.0E-11
sp|F8DVL8|ADH2_ZYMMA Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=adhB PE=3 SV=1 52 393 3.0E-11
sp|P0DJA2|ADH2_ZYMMO Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhB PE=1 SV=1 52 393 4.0E-11
sp|O84992|MACA1_RHOOP Maleylacetate reductase 1 OS=Rhodococcus opacus GN=macA PE=3 SV=1 45 314 6.0E-10
sp|P45513|DHAT_CITFR 1,3-propanediol dehydrogenase OS=Citrobacter freundii GN=dhaT PE=3 SV=1 105 411 1.0E-09
sp|Q24803|ADH2_ENTHI Aldehyde-alcohol dehydrogenase 2 OS=Entamoeba histolytica GN=ADH2 PE=1 SV=1 105 314 1.0E-09
sp|P41795|EUTG_SALTY Ethanolamine utilization protein EutG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=eutG PE=3 SV=2 92 410 2.0E-09
sp|Q59477|DHAT_KLEPN 1,3-propanediol dehydrogenase OS=Klebsiella pneumoniae GN=dhaT PE=1 SV=1 77 393 1.0E-08
sp|P13604|ADH1_CLOSA NADPH-dependent butanol dehydrogenase OS=Clostridium saccharobutylicum GN=adh1 PE=3 SV=1 75 340 8.0E-08
sp|A4IP64|ADH1_GEOTN Long-chain-alcohol dehydrogenase 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh1 PE=1 SV=1 88 310 1.0E-07
sp|P71017|GBSB_BACSU Alcohol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsB PE=1 SV=2 93 401 6.0E-07
sp|Q9RCG0|MNO_AMYME Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Amycolatopsis methanolica GN=mno PE=1 SV=1 87 311 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4003
MTAPETDFFQGTETHRPAFNRQPTPAISYGLRFPDACAKHVTSDLASERVYVIASSSLANKTDALQQLTAALGSR
IVGVRKGVGAHTPLDHVVEIVAEARNLDVDCLVTLGSGSITDCAKIVRFALANSAHDLDSVAKLGGDHNGKWAKP
TIRLICIPTSLSGGEYQARAGATDPKTLHKNIFYPGAEIDLVIQDPELCSKTPDWLWFSSGIRAVDHCVETLCSL
LSNKAGDECSGRGLDKLVPSLLQTKANPQNLRFRHTSQLGVIDSMEAVSSGIPLGASHAIGHQLGPLGVGHGETS
CIMLPAVCKYNASKGANNERQALTVAHLLKNQLVVDALRNRGLDPAKVDLGDTLDVIITELGMPRSLEELHIGPD
KLATIASSSIRDPWCKTNAVPITEESQVMDILKAALKSPNKSK*
Coding >OphauB2|4003
ATGACAGCACCAGAAACAGACTTTTTCCAAGGAACCGAGACTCATCGGCCTGCCTTCAACAGGCAGCCTACCCCG
GCTATTAGTTACGGACTCCGCTTCCCAGACGCCTGCGCTAAACATGTCACTAGCGACTTGGCTAGCGAGCGCGTC
TACGTTATTGCATCAAGTAGTCTTGCCAACAAGACAGATGCATTGCAGCAACTAACGGCGGCGCTTGGCAGCCGT
ATTGTTGGCGTTAGAAAGGGAGTTGGAGCTCACACGCCTCTTGACCATGTCGTCGAGATAGTTGCCGAGGCGCGT
AATCTCGACGTCGATTGCTTGGTCACTCTGGGTTCAGGCAGCATCACAGATTGTGCCAAGATAGTGCGCTTTGCT
CTGGCAAACTCTGCCCACGATCTGGACAGCGTTGCCAAGCTTGGCGGAGATCATAATGGCAAGTGGGCAAAGCCA
ACAATCCGCCTCATCTGTATTCCCACTTCGCTCTCTGGCGGCGAATATCAGGCTCGTGCTGGCGCCACGGATCCA
AAGACACTTCACAAGAACATCTTCTATCCAGGGGCTGAAATAGACCTCGTCATTCAAGATCCAGAGCTTTGCTCC
AAAACTCCCGACTGGCTGTGGTTTAGCTCGGGCATCCGGGCCGTTGACCATTGTGTCGAGACGCTTTGCTCTCTG
CTCAGCAATAAGGCGGGCGATGAATGCAGCGGCCGCGGCCTCGACAAGCTTGTGCCAAGTCTATTACAGACCAAG
GCCAACCCTCAAAATCTTCGTTTCCGTCACACAAGTCAGCTTGGTGTCATTGATTCCATGGAGGCTGTGTCGAGC
GGGATTCCCTTGGGCGCCAGTCATGCCATCGGCCATCAGCTTGGCCCACTAGGTGTCGGCCACGGTGAGACAAGC
TGTATCATGCTTCCTGCTGTATGCAAATACAACGCCAGCAAGGGAGCCAACAATGAGAGACAAGCCTTGACAGTC
GCACATCTGCTCAAAAATCAGCTGGTTGTCGATGCGCTACGAAACAGAGGCCTTGACCCTGCCAAGGTTGACTTG
GGGGATACTCTAGACGTTATTATTACAGAACTGGGAATGCCAAGGTCACTGGAAGAGCTTCATATTGGCCCAGAT
AAACTAGCCACCATTGCAAGCAGCTCGATTCGAGACCCTTGGTGCAAGACAAACGCGGTGCCTATAACGGAGGAA
TCGCAAGTCATGGATATACTCAAGGCTGCCTTGAAGTCTCCCAATAAGTCAAAATAG
Transcript >OphauB2|4003
ATGACAGCACCAGAAACAGACTTTTTCCAAGGAACCGAGACTCATCGGCCTGCCTTCAACAGGCAGCCTACCCCG
GCTATTAGTTACGGACTCCGCTTCCCAGACGCCTGCGCTAAACATGTCACTAGCGACTTGGCTAGCGAGCGCGTC
TACGTTATTGCATCAAGTAGTCTTGCCAACAAGACAGATGCATTGCAGCAACTAACGGCGGCGCTTGGCAGCCGT
ATTGTTGGCGTTAGAAAGGGAGTTGGAGCTCACACGCCTCTTGACCATGTCGTCGAGATAGTTGCCGAGGCGCGT
AATCTCGACGTCGATTGCTTGGTCACTCTGGGTTCAGGCAGCATCACAGATTGTGCCAAGATAGTGCGCTTTGCT
CTGGCAAACTCTGCCCACGATCTGGACAGCGTTGCCAAGCTTGGCGGAGATCATAATGGCAAGTGGGCAAAGCCA
ACAATCCGCCTCATCTGTATTCCCACTTCGCTCTCTGGCGGCGAATATCAGGCTCGTGCTGGCGCCACGGATCCA
AAGACACTTCACAAGAACATCTTCTATCCAGGGGCTGAAATAGACCTCGTCATTCAAGATCCAGAGCTTTGCTCC
AAAACTCCCGACTGGCTGTGGTTTAGCTCGGGCATCCGGGCCGTTGACCATTGTGTCGAGACGCTTTGCTCTCTG
CTCAGCAATAAGGCGGGCGATGAATGCAGCGGCCGCGGCCTCGACAAGCTTGTGCCAAGTCTATTACAGACCAAG
GCCAACCCTCAAAATCTTCGTTTCCGTCACACAAGTCAGCTTGGTGTCATTGATTCCATGGAGGCTGTGTCGAGC
GGGATTCCCTTGGGCGCCAGTCATGCCATCGGCCATCAGCTTGGCCCACTAGGTGTCGGCCACGGTGAGACAAGC
TGTATCATGCTTCCTGCTGTATGCAAATACAACGCCAGCAAGGGAGCCAACAATGAGAGACAAGCCTTGACAGTC
GCACATCTGCTCAAAAATCAGCTGGTTGTCGATGCGCTACGAAACAGAGGCCTTGACCCTGCCAAGGTTGACTTG
GGGGATACTCTAGACGTTATTATTACAGAACTGGGAATGCCAAGGTCACTGGAAGAGCTTCATATTGGCCCAGAT
AAACTAGCCACCATTGCAAGCAGCTCGATTCGAGACCCTTGGTGCAAGACAAACGCGGTGCCTATAACGGAGGAA
TCGCAAGTCATGGATATACTCAAGGCTGCCTTGAAGTCTCCCAATAAGTCAAAATAG
Gene >OphauB2|4003
ATGACAGCACCAGAAACAGACTTTTTCCAAGGAACCGAGACTCATCGGCCTGCCTTCAACAGGCAGCCTACCCCG
GCTATTAGTTACGGACTCCGCTTCCCAGACGCCTGCGCTAAACATGTCACTAGCGACTTGGCTAGCGAGCGCGTC
TACGTTATTGCATCAAGTAGTCTTGCCAACAAGACAGATGCATTGCAGCAACTAACGGCGGCGCTTGGCAGCCGT
ATTGTTGGCGTTAGAAAGGGAGTTGGAGCTCACACGCCTCTTGACCATGTCGTCGAGATAGTTGCCGAGGCGCGT
AATCTCGACGTCGATTGCTTGGTCACTCTGGGTTCAGGCAGCATCACAGATTGTGCCAAGATAGTGCGCTTTGCT
CTGGCAAACTCTGCCCACGATCTGGACAGCGTTGCCAAGCTTGGCGGAGATCATAATGGCAAGTGGGCAAAGCCA
ACAATCCGCCTCATCTGTATTCCCACTTCGCTCTCTGGCGGCGAATATCAGGCTCGTGCTGGCGCCACGGATCCA
AAGACACTTCACAAGAACATCTTCTATCCAGGGGCTGAAATAGACCTCGTCATTCAAGATCCAGAGCTTTGCTCC
AAAACTCCCGACTGGCTGTGGTTTAGCTCGGGCATCCGGGCCGTTGACCATTGTGTCGAGACGCTTTGCTCTCTG
CTCAGCAATAAGGCGGGCGATGAATGCAGCGGCCGCGGCCTCGACAAGCTTGTGCCAAGTCTATTACAGACCAAG
GCCAACCCTCAAAATCTTCGTTTCCGTCACACAAGTCAGCTTGGTGTCATTGATTCCATGGAGGCTGTGTCGAGC
GGGATTCCCTTGGGCGCCAGTCATGCCATCGGCCATCAGCTTGGCCCACTAGGTGTCGGCCACGGTGAGACAAGC
TGTATCATGCTTCCTGCTGTATGCAAATACAACGCCAGCAAGGGAGCCAACAATGAGAGACAAGCCTTGACAGTC
GCACATCTGCTCAAAAATCAGCTGGTTGTCGATGCGCTACGAAACAGAGGCCTTGACCCTGCCAAGGTTGACTTG
GGGGATACTCTAGACGTTATTATTACAGAACTGGGAATGCCAAGGTCACTGGAAGAGCTTCATATTGGCCCAGAT
AAACTAGCCACCATTGCAAGCAGCTCGATTCGAGACCCTTGGTGCAAGACAAACGCGGTGCCTATAACGGAGGAA
TCGCAAGTCATGGATATACTCAAGGCTGCCTTGAAGTCTCCCAATAAGTCAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail