Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4
Gene name
LocationContig_1:8735..9699
Strand-
Gene length (bp)964
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 1.1E-52 68 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74888|BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bxi1 PE=3 SV=1 6 274 2.0E-50
sp|Q9DA39|LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus GN=Tmbim4 PE=2 SV=1 39 274 4.0E-47
sp|Q9HC24|LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens GN=TMBIM4 PE=1 SV=3 41 274 1.0E-46
sp|Q49P94|GAAP_VACCL Golgi anti-apoptotic protein OS=Vaccinia virus (strain Lister) GN=L6 PE=1 SV=1 46 259 2.0E-40
sp|P48558|BXI1_YEAST Bax inhibitor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BXI1 PE=1 SV=1 22 274 4.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74888|BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bxi1 PE=3 SV=1 6 274 2.0E-50
sp|Q9DA39|LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus GN=Tmbim4 PE=2 SV=1 39 274 4.0E-47
sp|Q9HC24|LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens GN=TMBIM4 PE=1 SV=3 41 274 1.0E-46
sp|Q49P94|GAAP_VACCL Golgi anti-apoptotic protein OS=Vaccinia virus (strain Lister) GN=L6 PE=1 SV=1 46 259 2.0E-40
sp|P48558|BXI1_YEAST Bax inhibitor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BXI1 PE=1 SV=1 22 274 4.0E-38
sp|Q7Z429|LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens GN=GRINA PE=2 SV=1 2 269 5.0E-35
sp|Q9ESF4|LFG1_MOUSE Protein lifeguard 1 OS=Mus musculus GN=Grina PE=2 SV=1 64 269 9.0E-31
sp|Q6P6R0|LFG1_RAT Protein lifeguard 1 OS=Rattus norvegicus GN=Grina PE=2 SV=1 64 269 2.0E-30
sp|Q94A20|BI1L_ARATH BI1-like protein OS=Arabidopsis thaliana GN=At4g15470 PE=2 SV=1 39 273 2.0E-30
sp|Q1LZ71|LFG2_BOVIN Protein lifeguard 2 OS=Bos taurus GN=FAIM2 PE=2 SV=1 21 273 2.0E-28
sp|Q8K097|LFG2_MOUSE Protein lifeguard 2 OS=Mus musculus GN=Faim2 PE=2 SV=1 64 273 4.0E-28
sp|Q9BWQ8|LFG2_HUMAN Protein lifeguard 2 OS=Homo sapiens GN=FAIM2 PE=1 SV=1 64 273 1.0E-27
sp|Q32L53|LFG1_BOVIN Protein lifeguard 1 OS=Bos taurus GN=GRINA PE=2 SV=1 2 269 2.0E-27
sp|O88407|LFG2_RAT Protein lifeguard 2 OS=Rattus norvegicus GN=Faim2 PE=2 SV=1 64 273 2.0E-27
sp|Q969X1|LFG3_HUMAN Protein lifeguard 3 OS=Homo sapiens GN=TMBIM1 PE=1 SV=2 64 272 5.0E-27
sp|Q5R4I4|LFG2_PONAB Protein lifeguard 2 OS=Pongo abelii GN=FAIM2 PE=2 SV=1 64 273 6.0E-27
sp|Q11080|TMBI4_CAEEL Transmembrane BAX inhibitor motif-containing protein 4 OS=Caenorhabditis elegans GN=tmbi-4 PE=3 SV=2 43 273 4.0E-24
sp|Q8BJZ3|LFG3_MOUSE Protein lifeguard 3 OS=Mus musculus GN=Tmbim1 PE=1 SV=1 64 272 1.0E-23
sp|Q9PIQ8|Y236_CAMJE Uncharacterized protein Cj0236c OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj0236c PE=3 SV=1 69 273 6.0E-18
sp|Q5XDQ1|Y327_STRP6 Uncharacterized membrane protein M6_Spy0327 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0327 PE=3 SV=1 126 272 8.0E-14
sp|Q9A1B9|Y358_STRP1 Uncharacterized membrane protein SPy_0358/M5005_Spy0301 OS=Streptococcus pyogenes serotype M1 GN=SPy_0358 PE=3 SV=1 126 272 8.0E-14
sp|Q8P2D4|Y408_STRP8 Uncharacterized membrane protein spyM18_0408 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_0408 PE=3 SV=1 126 272 8.0E-14
sp|P0DA11|Y260_STRPQ Uncharacterized membrane protein SPs1599 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1599 PE=3 SV=1 126 272 1.0E-13
sp|P0DA10|Y260_STRP3 Uncharacterized membrane protein SpyM3_0260 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0260 PE=3 SV=1 126 272 1.0E-13
sp|Q9KSA1|Y1358_VIBCH Uncharacterized membrane protein VC_1358 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1358 PE=3 SV=1 158 274 1.0E-11
sp|O51489|Y539_BORBU Uncharacterized protein BB_0539 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0539 PE=3 SV=1 65 274 1.0E-11
sp|Q9ZKT1|Y920_HELPJ Uncharacterized protein jhp_0854 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0854 PE=3 SV=1 109 269 9.0E-11
sp|O31539|YETJ_BACSU Uncharacterized protein YetJ OS=Bacillus subtilis (strain 168) GN=yetJ PE=1 SV=1 121 272 4.0E-10
sp|O25578|Y920_HELPY Uncharacterized protein HP_0920 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0920 PE=3 SV=1 109 269 8.0E-10
sp|Q9CEU8|YRJE_LACLA Uncharacterized protein YrjE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yrjE PE=3 SV=2 64 274 1.0E-08
sp|P09723|US21_HCMVA Uncharacterized protein HWLF2 OS=Human cytomegalovirus (strain AD169) GN=US21 PE=3 SV=1 66 274 3.0E-07
sp|F5HHT6|US21_HCMVM Membrane protein US21 OS=Human cytomegalovirus (strain Merlin) GN=US21 PE=3 SV=1 66 274 3.0E-07
sp|Q9RVX8|Y893_DEIRA Uncharacterized protein DR_0893 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_0893 PE=3 SV=1 60 272 1.0E-06
sp|P0AAC4|YBHL_ECOLI Inner membrane protein YbhL OS=Escherichia coli (strain K12) GN=ybhL PE=1 SV=1 67 272 4.0E-06
sp|P0AAC5|YBHL_ECOL6 Inner membrane protein YbhL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybhL PE=3 SV=1 67 272 4.0E-06
sp|Q9ZE15|Y147_RICPR Uncharacterized protein RP147 OS=Rickettsia prowazekii (strain Madrid E) GN=RP147 PE=3 SV=1 67 273 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 107 124 17
3 129 151 22
4 158 177 19
5 187 209 22
6 216 238 22
7 248 270 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4
MASNPRYQPAPQQDPDDYTRAPPAYGAAQSRQDEQGIFGAPRNSEDNIPDDFKFGGSVAEATVDIRHQFIRKVYT
ILTAQLVVTAGISSISFFSASYKSWIQSHEALVWISLIGSLVFLGLTYWKRKSYPTNILFISLFTATEAYTISVI
VSFYRTSIVLNAVILTAAIFVFLSLFACQTRYDFTSWMPYLFGALWGLLIFGLMAAFFPYNSTIELIYSGVAALV
FSAYILVDTQLIMRKHHVEEEIAAAISLYLDIINLFLAILRILNSQNNN*
Coding >OphauB2|4
ATGGCGTCGAATCCACGCTACCAGCCTGCGCCCCAGCAGGACCCAGACGACTACACGCGCGCGCCGCCCGCCTAC
GGTGCCGCCCAGTCCCGCCAAGATGAACAAGGCATCTTTGGCGCGCCGCGCAACAGCGAAGACAATATCCCCGAC
GACTTCAAGTTTGGCGGTTCTGTCGCAGAAGCCACAGTCGACATTCGCCATCAGTTTATTCGCAAAGTATACACT
ATTCTGACGGCCCAACTCGTTGTCACTGCCGGCATTAGCTCCATCTCCTTCTTCAGCGCCTCGTACAAGTCGTGG
ATTCAAAGCCATGAGGCCCTCGTTTGGATCTCACTCATTGGCTCTCTCGTCTTTCTCGGCCTCACATACTGGAAG
CGCAAGTCATATCCCACAAACATACTCTTCATCAGCCTCTTCACCGCCACGGAAGCGTACACCATCTCCGTCATT
GTTTCCTTCTATCGCACGTCGATTGTTCTCAACGCTGTCATTCTCACGGCTGCAATCTTCGTCTTTCTCTCCCTC
TTTGCTTGCCAGACGCGCTACGACTTTACCTCGTGGATGCCCTACCTATTTGGTGCCTTGTGGGGTCTCTTGATC
TTTGGCCTCATGGCTGCCTTTTTCCCCTACAACTCCACCATCGAACTCATCTACAGCGGTGTTGCTGCCCTCGTC
TTCAGCGCATATATCCTTGTCGACACGCAGCTCATCATGCGCAAGCATCATGTTGAGGAGGAAATTGCTGCTGCC
ATTAGTCTTTACCTCGACATTATCAACCTCTTCCTCGCCATTCTGCGCATTCTGAATAGCCAAAACAACAACTAG
Transcript >OphauB2|4
ATGGCGTCGAATCCACGCTACCAGCCTGCGCCCCAGCAGGACCCAGACGACTACACGCGCGCGCCGCCCGCCTAC
GGTGCCGCCCAGTCCCGCCAAGATGAACAAGGCATCTTTGGCGCGCCGCGCAACAGCGAAGACAATATCCCCGAC
GACTTCAAGTTTGGCGGTTCTGTCGCAGAAGCCACAGTCGACATTCGCCATCAGTTTATTCGCAAAGTATACACT
ATTCTGACGGCCCAACTCGTTGTCACTGCCGGCATTAGCTCCATCTCCTTCTTCAGCGCCTCGTACAAGTCGTGG
ATTCAAAGCCATGAGGCCCTCGTTTGGATCTCACTCATTGGCTCTCTCGTCTTTCTCGGCCTCACATACTGGAAG
CGCAAGTCATATCCCACAAACATACTCTTCATCAGCCTCTTCACCGCCACGGAAGCGTACACCATCTCCGTCATT
GTTTCCTTCTATCGCACGTCGATTGTTCTCAACGCTGTCATTCTCACGGCTGCAATCTTCGTCTTTCTCTCCCTC
TTTGCTTGCCAGACGCGCTACGACTTTACCTCGTGGATGCCCTACCTATTTGGTGCCTTGTGGGGTCTCTTGATC
TTTGGCCTCATGGCTGCCTTTTTCCCCTACAACTCCACCATCGAACTCATCTACAGCGGTGTTGCTGCCCTCGTC
TTCAGCGCATATATCCTTGTCGACACGCAGCTCATCATGCGCAAGCATCATGTTGAGGAGGAAATTGCTGCTGCC
ATTAGTCTTTACCTCGACATTATCAACCTCTTCCTCGCCATTCTGCGCATTCTGAATAGCCAAAACAACAACTAG
Gene >OphauB2|4
ATGGCGTCGAATCCACGCTACCAGCCTGCGCCCCAGCAGGACCCAGACGACTACACGCGCGCGCCGCCCGCCTAC
GGTGCCGCCCAGTCCCGCCAAGATGAACAAGGCATCTTTGGCGCGCCGCGCAACAGCGAAGACAATATCCCCGAC
GACTTCAAGGTGCGCATGCCCCGTCTTGGGCCCCAAGTCCATGTCTCAAGCTCATGTCTAATGTCCAACTCCAGT
TTGGCGGTTCTGTCGCAGAAGCCACAGTCGACATTCGCCATCAGTTTATTCGCAAAGTATACACTATTCTGACGG
CCCAACTCGTTGTCACTGCCGGCATTAGCTCCATCTCCTTCTTCAGCGCCTCGTACAAGTCGTGGATTCAAAGCC
ATGAGGCCCTCGTTTGGATCTCAGTACGTCATGCAACTCTAAATGCCCTTTTTTATACACGTCTTTTCTTTGCTT
GCATTTACTAACAACCTACCAGCTCATTGGCTCTCTCGTCTTTCTCGGCCTCACATACTGGAAGCGCAAGTCATA
TCCCACAAACATACTCTTCATCAGCCTCTTCACCGCCACGGAAGCGTACACCATCTCCGTCATTGTTTCCTTCTA
TCGCACGTCGATTGTTCTCAACGCTGTCATTCTCACGGCTGCAATCTTCGTCTTTCTCTCCCTCTTTGCTTGCCA
GACGCGCTACGACTTTACCTCGTGGATGCCCTACCTATTTGGTGCCTTGTGGGGTCTCTTGATCTTTGGCCTCAT
GGCTGCCTTTTTCCCCTACAACTCCACCATCGAACTCATCTACAGCGGTGTTGCTGCCCTCGTCTTCAGCGCATA
TATCCTTGTCGACACGCAGCTCATCATGCGCAAGCATCATGTTGAGGAGGAAATTGCTGCTGCCATTAGTCTTTA
CCTCGACATTATCAACCTCTTCCTCGCCATTCTGCGCATTCTGAATAGCCAAAACAACAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail