Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3995
Gene name
LocationContig_26:38470..40487
Strand+
Gene length (bp)2017
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07969 Amidohydro_3 Amidohydrolase family 5.4E-63 70 592
PF01979 Amidohydro_1 Amidohydrolase family 1.1E-08 526 591

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34355|YTCJ_BACSU Putative amidohydrolase YtcJ OS=Bacillus subtilis (strain 168) GN=ytcJ PE=4 SV=1 26 592 4.0E-34
sp|Q68AP4|NFDA_ARTPS N-substituted formamide deformylase OS=Arthrobacter pascens GN=nfdA PE=1 SV=1 24 592 7.0E-30
sp|Q06555|AEPA_PECCC Exoenzymes regulatory protein AepA OS=Pectobacterium carotovorum subsp. carotovorum GN=aepA PE=3 SV=1 23 449 6.0E-17

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3995
MALFFTVVFSMVHNSLAQVQSTADFVFTNGSIYTMDSLSTRVEALAIKDGTISFVGSSADVKDWVGDGTKVVDLQ
NRMVMPGLIDSHIHVRQGGLALTQCDLNYQPLGLDEVVKHIQGCIDSDTAKTDDDWLPVANLDYQTLVEQSGIIG
KMQLDQLKTRRPIFIISSDQHTGILNSRGLEVAKVTADTPDPPGGKIERLQGSNEPSGVLQDMATSLIPDPPVSE
DEKVEALVAALKLLREAGITTFQEAFALEEDYPVYERIRSENKLSARGFFDLFVDVPKSVNDVDSIVGKASETIS
KMHDNSTMGPGPTLKCQAIKGFLDGVIAFPAMTASLIDPYLSPVENSTTEWAPDPKTMIAPTWSPEILTKMLEQL
FLKGIDAQLHVDGDLAVRTALDAAETFTKKHPEHDFRLGLAHDELSHPDDWPRFNQLKVDAIVSFQWSQPGPAWI
PNTFLSLSESRLNNLEAYSKIEAAGRPVIYGSDWPIDPMDYFLALKVGVTRTGDAKNPHSPASKGAPFDGVFPGE
GISRESVLRAITINGARFLRADNHIGSLEPGKLADVVVLDKNFFEVPDEELGTLRVQLTMLGGEVVYVADEAKEL
GLEAKFPNNDQNAKKLDLRAVGGFNSRLLSAEGKAAIVRLRRQGECKSKHSG*
Coding >OphauB2|3995
ATGGCGCTCTTTTTTACAGTGGTTTTCTCCATGGTACACAATTCTCTCGCACAGGTGCAGTCAACAGCGGACTTT
GTGTTTACAAATGGATCGATTTATACCATGGACTCGCTCTCTACTAGAGTTGAGGCTCTGGCTATCAAAGATGGA
ACAATCTCATTTGTTGGCTCCTCAGCTGATGTCAAAGATTGGGTTGGAGATGGAACAAAAGTCGTCGATTTGCAA
AATCGCATGGTCATGCCAGGACTTATAGACTCACACATACATGTTCGTCAAGGTGGACTTGCATTGACACAGTGT
GATCTCAACTATCAGCCTCTGGGTCTCGACGAAGTTGTCAAGCATATACAAGGCTGCATCGATTCTGACACGGCA
AAGACAGACGATGACTGGCTGCCAGTTGCCAATCTGGATTACCAAACGCTCGTCGAACAGAGTGGGATTATTGGC
AAGATGCAGCTAGACCAACTCAAGACCCGTCGACCTATTTTTATAATCTCGTCGGACCAACATACTGGTATATTA
AACTCGCGCGGCTTAGAGGTGGCAAAAGTTACAGCCGATACGCCGGATCCTCCAGGCGGTAAAATTGAACGTTTA
CAAGGGAGCAATGAACCTTCTGGCGTATTGCAGGACATGGCAACAAGTCTTATCCCTGATCCGCCGGTTTCCGAA
GATGAAAAAGTTGAGGCTCTCGTTGCGGCTCTAAAATTACTTCGCGAGGCTGGCATTACGACTTTCCAAGAGGCT
TTTGCTCTCGAGGAGGACTATCCAGTTTATGAGAGAATACGTAGCGAGAACAAATTAAGTGCTCGCGGCTTTTTC
GATCTCTTTGTCGATGTTCCCAAGTCAGTCAACGACGTGGATTCCATCGTGGGCAAAGCGTCAGAAACGATTTCC
AAGATGCATGACAACTCCACAATGGGACCAGGGCCGACTCTCAAGTGTCAAGCCATCAAGGGTTTTCTCGATGGC
GTTATCGCCTTTCCTGCCATGACGGCCTCTCTAATAGACCCGTACCTGAGCCCCGTGGAAAACTCTACTACTGAA
TGGGCCCCTGATCCCAAGACGATGATTGCACCTACCTGGAGTCCTGAGATTTTGACTAAAATGCTGGAGCAGCTA
TTTCTCAAAGGCATTGACGCGCAGCTCCATGTAGATGGAGATCTTGCTGTGCGCACTGCCCTCGATGCAGCAGAG
ACGTTTACCAAGAAACATCCAGAGCACGACTTCAGACTTGGCTTAGCACACGACGAGCTCTCACATCCGGATGAC
TGGCCACGTTTCAATCAGCTCAAAGTGGATGCCATCGTGTCATTTCAATGGTCACAGCCTGGACCAGCATGGATT
CCTAACACATTTCTTTCCCTATCAGAGTCTCGGTTGAACAACCTCGAAGCGTATAGCAAGATTGAGGCTGCTGGG
CGGCCCGTAATATATGGCAGTGATTGGCCAATTGATCCCATGGACTATTTTCTGGCACTCAAGGTCGGCGTGACA
CGCACTGGAGATGCAAAGAATCCTCATTCTCCAGCATCAAAGGGAGCACCTTTTGATGGTGTATTTCCCGGAGAG
GGCATATCCCGCGAAAGCGTCCTCCGAGCCATTACCATTAATGGAGCGCGGTTTCTCCGCGCAGACAACCATATT
GGCTCACTTGAGCCTGGAAAGCTAGCTGACGTGGTTGTGCTGGACAAGAACTTTTTTGAAGTGCCTGACGAAGAG
CTAGGCACCTTGCGCGTGCAGCTAACTATGCTGGGTGGTGAAGTAGTTTACGTGGCTGATGAGGCAAAGGAACTA
GGCCTCGAGGCAAAGTTTCCCAATAATGATCAGAATGCAAAGAAGCTGGACCTAAGAGCGGTTGGTGGGTTCAAT
TCGCGGCTGCTTTCTGCCGAGGGTAAAGCAGCTATAGTTAGGCTTAGAAGACAAGGAGAGTGCAAGAGTAAGCAC
TCGGGATGA
Transcript >OphauB2|3995
ATGGCGCTCTTTTTTACAGTGGTTTTCTCCATGGTACACAATTCTCTCGCACAGGTGCAGTCAACAGCGGACTTT
GTGTTTACAAATGGATCGATTTATACCATGGACTCGCTCTCTACTAGAGTTGAGGCTCTGGCTATCAAAGATGGA
ACAATCTCATTTGTTGGCTCCTCAGCTGATGTCAAAGATTGGGTTGGAGATGGAACAAAAGTCGTCGATTTGCAA
AATCGCATGGTCATGCCAGGACTTATAGACTCACACATACATGTTCGTCAAGGTGGACTTGCATTGACACAGTGT
GATCTCAACTATCAGCCTCTGGGTCTCGACGAAGTTGTCAAGCATATACAAGGCTGCATCGATTCTGACACGGCA
AAGACAGACGATGACTGGCTGCCAGTTGCCAATCTGGATTACCAAACGCTCGTCGAACAGAGTGGGATTATTGGC
AAGATGCAGCTAGACCAACTCAAGACCCGTCGACCTATTTTTATAATCTCGTCGGACCAACATACTGGTATATTA
AACTCGCGCGGCTTAGAGGTGGCAAAAGTTACAGCCGATACGCCGGATCCTCCAGGCGGTAAAATTGAACGTTTA
CAAGGGAGCAATGAACCTTCTGGCGTATTGCAGGACATGGCAACAAGTCTTATCCCTGATCCGCCGGTTTCCGAA
GATGAAAAAGTTGAGGCTCTCGTTGCGGCTCTAAAATTACTTCGCGAGGCTGGCATTACGACTTTCCAAGAGGCT
TTTGCTCTCGAGGAGGACTATCCAGTTTATGAGAGAATACGTAGCGAGAACAAATTAAGTGCTCGCGGCTTTTTC
GATCTCTTTGTCGATGTTCCCAAGTCAGTCAACGACGTGGATTCCATCGTGGGCAAAGCGTCAGAAACGATTTCC
AAGATGCATGACAACTCCACAATGGGACCAGGGCCGACTCTCAAGTGTCAAGCCATCAAGGGTTTTCTCGATGGC
GTTATCGCCTTTCCTGCCATGACGGCCTCTCTAATAGACCCGTACCTGAGCCCCGTGGAAAACTCTACTACTGAA
TGGGCCCCTGATCCCAAGACGATGATTGCACCTACCTGGAGTCCTGAGATTTTGACTAAAATGCTGGAGCAGCTA
TTTCTCAAAGGCATTGACGCGCAGCTCCATGTAGATGGAGATCTTGCTGTGCGCACTGCCCTCGATGCAGCAGAG
ACGTTTACCAAGAAACATCCAGAGCACGACTTCAGACTTGGCTTAGCACACGACGAGCTCTCACATCCGGATGAC
TGGCCACGTTTCAATCAGCTCAAAGTGGATGCCATCGTGTCATTTCAATGGTCACAGCCTGGACCAGCATGGATT
CCTAACACATTTCTTTCCCTATCAGAGTCTCGGTTGAACAACCTCGAAGCGTATAGCAAGATTGAGGCTGCTGGG
CGGCCCGTAATATATGGCAGTGATTGGCCAATTGATCCCATGGACTATTTTCTGGCACTCAAGGTCGGCGTGACA
CGCACTGGAGATGCAAAGAATCCTCATTCTCCAGCATCAAAGGGAGCACCTTTTGATGGTGTATTTCCCGGAGAG
GGCATATCCCGCGAAAGCGTCCTCCGAGCCATTACCATTAATGGAGCGCGGTTTCTCCGCGCAGACAACCATATT
GGCTCACTTGAGCCTGGAAAGCTAGCTGACGTGGTTGTGCTGGACAAGAACTTTTTTGAAGTGCCTGACGAAGAG
CTAGGCACCTTGCGCGTGCAGCTAACTATGCTGGGTGGTGAAGTAGTTTACGTGGCTGATGAGGCAAAGGAACTA
GGCCTCGAGGCAAAGTTTCCCAATAATGATCAGAATGCAAAGAAGCTGGACCTAAGAGCGGTTGGTGGGTTCAAT
TCGCGGCTGCTTTCTGCCGAGGGTAAAGCAGCTATAGTTAGGCTTAGAAGACAAGGAGAGTGCAAGAGTAAGCAC
TCGGGATGA
Gene >OphauB2|3995
ATGGCGCTCTTTTTTACAGTGGTTTTCTCCATGGTACACAATTCTCTCGCACAGGTGCAGTCAACAGCGGACTTT
GTGTTTACAAATGGATCGATTTATACCATGGACTCGCTCTCTACTAGAGTTGAGGCTCTGGCTATCAAAGATGGA
ACAATCTCATTTGTTGGCTCCTCAGCTGATGTCAAAGATTGGGTTGGAGATGGAACAAAAGTCGTCGATTTGCAA
AATCGCATGGTCATGCCAGGACTTATAGACTCACACATACATGTTCGTCAAGGTGGACTTGCATTGACACAGTGT
GATCTCAACTATCAGCCTCTGGGTCTCGACGAAGTTGTCAAGCATATACAAGGCTGCATCGATTCTGACACGGCA
AAGACAGACGATGACTGGCTGCCAGTTGCCAATCTGGATTACCAAACGCTCGTCGAACAGAGTGGGATTATTGGC
AAGATGCAGCTAGACCAACTCAAGACCCGTCGACCTATTTTTATAATCTCGTCGGACCAACATACTGGTATATTA
AACTCGCGCGGCTTAGAGGTGGCAAAAGTTACAGCCGATACGCCGGATCCTCCAGGCGGTAAAATTGAACGTTTA
CAAGGGAGCAATGAACCTTCTGGCGTATTGCAGGACATGGCAACAAGTCTTATCCCTGATCCGCCGGTTTCCGAA
GATGAAAAAGTTGAGGCTCTCGTTGCGGCTCTAAAATTACTTCGCGAGGCTGGCATTACGACTTTCCAAGAGGCT
TTTGCTCTCGAGGAGGACTATCCAGTTTATGAGAGAATACGTAGCGAGAACAAATTAAGTGCTCGCGGCTTTTTC
GATCTCTTTGTCGATGTTCCCAAGTCAGTCAACGACGTGGATTCCATCGTGGGCAAAGCGTCAGAAACGATTTCC
AAGATGCATGACAACTCCACAATGGGACCAGGGCCGACTCTCAAGTGTCAAGCCATCAAGGGTTTTCTCGATGGC
GTTATCGCCTTTCCTGCCATGACGGCCTCTCTAATAGACCCGTACCTGAGCCCCGTGGAAAACTCTACTACTGAA
TGGGCCCCTGATCCCAAGACGATGATTGCACCTACCTGGAGTCCTGAGATTTTGACTAAAATGCTGGAGCAGCTA
TTTCTCAAAGGCATTGACGCGCAGCTCCATGTAGATGGAGATCTTGCTGTGCGCACTGCCCTCGATGCAGCAGAG
ACGTTTACCAAGAAACATCCAGAGCACGACTTCAGACTTGGCTTAGCACACGACGAGCTCTCACATCCGGATGAC
TGGCCACGTTTCAATCAGCTCAAAGTGGATGCCATCGTGTCATTTCAATGGTCACAGCCTGGACCAGCATGGATT
CCTAACACATTTCTTTCCCTATCAGAGTCTCGGTTGAACAACCTCGAAGCGTATAGCAAGATTGAGGCTGCTGGG
CGGCCCGTAATATATGGCAGTGATTGGCCAGTCAGTACTTGAACGGGTAACTCTTCTACCAAGACAAGCTCTAAC
TGCAGAGTAATAGATTGATCCCATGGACTATTTTCTGGCACTCAAGGTCGGCGTGACACGCACTGGAGATGCAAA
GAATCCTCATTCTCCAGCATCAAAGGGAGCACCTTTTGATGGTGTATTTCCCGGAGAGGGCATATCCCGCGAAAG
CGTCCTCCGAGCCATTACCATTAATGGAGCGCGGTTTCTCCGCGCAGACAACCATATTGGCTCACTTGAGCCTGG
AAAGCTAGCTGACGTGGTTGTGCTGGACAAGAACTTTTTTGAAGTGCCTGACGAAGAGCTAGGCACCTTGCGCGT
GCAGCTAACTATGCTGGGTGGTGAAGTAGTTTACGTGGCTGATGAGGCAAAGGAACTAGGCCTCGAGGCAAAGTT
TCCCAATAATGATCAGAATGCAAAGAAGCTGGACCTAAGAGCGGTTGGTGGGTTCAATTCGCGGCTGCTTTCTGC
CGAGGGTAAAGCAGCTATAGTTAGGCTTAGAAGACAAGGAGAGTGCAAGAGTAAGCACTCGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail