Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3994
Gene name
LocationContig_26:36976..37579
Strand-
Gene length (bp)603
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 104 175 4.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup23
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1466
Ophiocordyceps australis 1348a (Ghana) OphauG2|2796
Ophiocordyceps australis map64 (Brazil) OphauB2|3994 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|591
Ophiocordyceps australis map64 (Brazil) OphauB2|6458
Ophiocordyceps camponoti-floridani Ophcf2|06420
Ophiocordyceps camponoti-floridani Ophcf2|02533
Ophiocordyceps camponoti-floridani Ophcf2|04590
Ophiocordyceps camponoti-floridani Ophcf2|06808
Ophiocordyceps camponoti-rufipedis Ophun1|3755
Ophiocordyceps camponoti-rufipedis Ophun1|2002
Ophiocordyceps camponoti-rufipedis Ophun1|1119
Ophiocordyceps camponoti-rufipedis Ophun1|7502
Ophiocordyceps camponoti-rufipedis Ophun1|4159
Ophiocordyceps kimflemingae Ophio5|2066
Ophiocordyceps kimflemingae Ophio5|3352
Ophiocordyceps kimflemingae Ophio5|360
Ophiocordyceps kimflemingae Ophio5|4122
Ophiocordyceps kimflemingae Ophio5|5606
Ophiocordyceps subramaniannii Hirsu2|7822
Ophiocordyceps subramaniannii Hirsu2|6429
Ophiocordyceps subramaniannii Hirsu2|16
Ophiocordyceps subramaniannii Hirsu2|10639

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3994
MVGSGRDNPCGDGQVRREVVLGPWLSVDLVLAQVDPVVLALVLVGAKVGQDVAPRAGGAGPHFADEGLDLKEADE
ANPAGNVLGLEKNAHDGILMQASVSIRTSELEEWARPKVRAFAASIDVGVLPWIYLNYAHASQMVLQSYGPDNVR
RMREAAAKYDADGVFQRLCPGGFKISAVKD*
Coding >OphauB2|3994
ATGGTCGGGAGCGGCAGAGACAATCCCTGTGGTGACGGCCAGGTCCGGCGCGAGGTGGTCCTCGGACCGTGGCTC
TCGGTCGATCTTGTCCTGGCTCAGGTAGATCCTGTTGTACTTGCTCTTGTCCTTGTTGGAGCCAAAGTCGGCCAG
GACGTGGCACCTAGAGCCGGAGGAGCCGGACCTCACTTTGCCGACGAGGGGCTGGATCTCAAAGAGGCTGATGAG
GCCAACCCGGCCGGCAACGTGCTGGGCCTCGAGAAAAACGCCCACGACGGCATCCTAATGCAGGCCTCGGTCAGC
ATCCGCACCTCGGAGCTTGAGGAATGGGCCCGTCCCAAGGTCCGCGCCTTTGCCGCCTCTATTGACGTCGGCGTC
TTGCCCTGGATATACCTCAACTACGCCCACGCCAGTCAAATGGTGCTACAGAGCTACGGGCCGGACAATGTGCGC
AGGATGCGCGAGGCCGCTGCCAAGTACGATGCCGACGGCGTCTTTCAGCGTCTATGCCCAGGAGGTTTCAAGATT
TCGGCAGTCAAGGACTAA
Transcript >OphauB2|3994
ATGGTCGGGAGCGGCAGAGACAATCCCTGTGGTGACGGCCAGGTCCGGCGCGAGGTGGTCCTCGGACCGTGGCTC
TCGGTCGATCTTGTCCTGGCTCAGGTAGATCCTGTTGTACTTGCTCTTGTCCTTGTTGGAGCCAAAGTCGGCCAG
GACGTGGCACCTAGAGCCGGAGGAGCCGGACCTCACTTTGCCGACGAGGGGCTGGATCTCAAAGAGGCTGATGAG
GCCAACCCGGCCGGCAACGTGCTGGGCCTCGAGAAAAACGCCCACGACGGCATCCTAATGCAGGCCTCGGTCAGC
ATCCGCACCTCGGAGCTTGAGGAATGGGCCCGTCCCAAGGTCCGCGCCTTTGCCGCCTCTATTGACGTCGGCGTC
TTGCCCTGGATATACCTCAACTACGCCCACGCCAGTCAAATGGTGCTACAGAGCTACGGGCCGGACAATGTGCGC
AGGATGCGCGAGGCCGCTGCCAAGTACGATGCCGACGGCGTCTTTCAGCGTCTATGCCCAGGAGGTTTCAAGATT
TCGGCAGTCAAGGACTAA
Gene >OphauB2|3994
ATGGTCGGGAGCGGCAGAGACAATCCCTGTGGTGACGGCCAGGTCCGGCGCGAGGTGGTCCTCGGACCGTGGCTC
TCGGTCGATCTTGTCCTGGCTCAGGTAGATCCTGTTGTACTTGCTCTTGTCCTTGTTGGAGCCAAAGTCGGCCAG
GACGTGGCACCTAGAGCCGGAGGAGCCGGACCTCACTTTGCCGACGAGGGGCTGGATGTAGGCACGGAAACGGGG
CGCAAGGGTGGGGATGCAGACGATGATGATGCCGAACCATAGCTCAAAGAGGCTGATGAGGCCAACCCGGCCGGC
AACGTGCTGGGCCTCGAGAAAAACGCCCACGACGGCATCCTAATGCAGGCCTCGGTCAGCATCCGCACCTCGGAG
CTTGAGGAATGGGCCCGTCCCAAGGTCCGCGCCTTTGCCGCCTCTATTGACGTCGGCGTCTTGCCCTGGATATAC
CTCAACTACGCCCACGCCAGTCAAATGGTGCTACAGAGCTACGGGCCGGACAATGTGCGCAGGATGCGCGAGGCC
GCTGCCAAGTACGATGCCGACGGCGTCTTTCAGCGTCTATGCCCAGGAGGTTTCAAGATTTCGGCAGTCAAGGAC
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail