Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3988
Gene name
LocationContig_26:18220..19276
Strand+
Gene length (bp)1056
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10261 Scs3p Inositol phospholipid synthesis and fat-storage-inducing TM 3.0E-71 83 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM4|SCS3_SCHPO FIT family protein scs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scs3 PE=3 SV=1 78 319 8.0E-29
sp|A0JP80|FITM2_XENTR Fat storage-inducing transmembrane protein 2 OS=Xenopus tropicalis GN=fitm2 PE=2 SV=1 81 306 6.0E-11
sp|Q9VRJ2|FITM_DROME FIT family protein CG10671 OS=Drosophila melanogaster GN=CG10671 PE=1 SV=1 84 311 2.0E-10
sp|Q52KL1|FITM2_DANRE Fat storage-inducing transmembrane protein 2 OS=Danio rerio GN=fitm2 PE=2 SV=1 77 308 5.0E-10
sp|P59266|FITM2_MOUSE Fat storage-inducing transmembrane protein 2 OS=Mus musculus GN=Fitm2 PE=1 SV=1 81 306 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM4|SCS3_SCHPO FIT family protein scs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scs3 PE=3 SV=1 78 319 8.0E-29
sp|A0JP80|FITM2_XENTR Fat storage-inducing transmembrane protein 2 OS=Xenopus tropicalis GN=fitm2 PE=2 SV=1 81 306 6.0E-11
sp|Q9VRJ2|FITM_DROME FIT family protein CG10671 OS=Drosophila melanogaster GN=CG10671 PE=1 SV=1 84 311 2.0E-10
sp|Q52KL1|FITM2_DANRE Fat storage-inducing transmembrane protein 2 OS=Danio rerio GN=fitm2 PE=2 SV=1 77 308 5.0E-10
sp|P59266|FITM2_MOUSE Fat storage-inducing transmembrane protein 2 OS=Mus musculus GN=Fitm2 PE=1 SV=1 81 306 8.0E-10
sp|B2LYG4|FITM2_PIG Fat storage-inducing transmembrane protein 2 OS=Sus scrofa GN=FITM2 PE=2 SV=1 81 306 1.0E-09
sp|A4IFN5|FITM2_BOVIN Fat storage-inducing transmembrane protein 2 OS=Bos taurus GN=FITM2 PE=2 SV=1 81 306 2.0E-09
sp|Q8N6M3|FITM2_HUMAN Fat storage-inducing transmembrane protein 2 OS=Homo sapiens GN=FITM2 PE=2 SV=1 81 306 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0019915 lipid storage Yes
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0016020 membrane No
GO:0008150 biological_process No
GO:0051235 maintenance of location No
GO:0005575 cellular_component No
GO:0031090 organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 41 60 19
2 90 112 22
3 127 149 22
4 266 288 22
5 292 314 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3988
MATQYPGGSHKAIDNGSNKASPLATIRPRNPPYLPTRLERLVTTLFPVLLVFGTLFSVISPQTRGAIYDPSQQAH
AQDAALVPSYFARKSNLFNVVFVKRGWAWTSLALLIFTASHPSVTSRSRVGLRWAAVTVCWILVTQWCFGAPVID
RGFRWTGGRCDMAEREISRGGAAEAGMADVLTAMACRTAGGHWRGGHDISGHVFLLVLSTAMLLQEVGWPLLRWT
GATEERTIIMSDGAVKGAGVEANMAPGRGRGKFELGVGGKTALVVGSLNVWMLLMTAIYFHTWFEKLTGLVTALV
AVYAVYIVPRFMPVIRAVLALPGI*
Coding >OphauB2|3988
ATGGCCACCCAGTACCCAGGTGGCTCGCATAAAGCGATTGACAATGGTTCCAACAAAGCCTCTCCTTTAGCAACA
ATTCGTCCGCGCAACCCTCCCTACCTTCCGACGCGACTGGAACGCCTCGTGACAACCCTTTTTCCGGTTCTGCTC
GTCTTCGGAACCCTATTTTCCGTCATTTCTCCACAGACTCGCGGCGCAATTTACGACCCAAGCCAACAGGCTCAC
GCGCAAGACGCAGCCCTAGTCCCAAGCTACTTTGCCCGCAAATCCAACCTCTTCAACGTTGTGTTTGTGAAGCGC
GGCTGGGCCTGGACCTCCTTGGCGCTCCTGATTTTTACCGCATCGCACCCCAGCGTGACATCGCGGTCACGCGTG
GGTCTACGCTGGGCAGCCGTAACGGTATGCTGGATCCTGGTGACTCAATGGTGCTTTGGCGCACCAGTAATTGAT
CGCGGCTTTCGGTGGACTGGCGGGAGATGCGACATGGCTGAGAGAGAAATTTCACGAGGCGGAGCAGCAGAGGCT
GGCATGGCGGATGTACTCACCGCCATGGCGTGCAGGACAGCCGGCGGCCACTGGAGAGGCGGTCATGACATCTCG
GGACATGTCTTTCTGCTTGTTCTAAGCACTGCAATGCTTTTGCAAGAAGTAGGCTGGCCGCTGCTAAGATGGACA
GGTGCCACGGAGGAGCGAACTATCATCATGTCCGACGGAGCTGTCAAGGGCGCAGGCGTTGAGGCAAACATGGCT
CCTGGACGCGGGCGCGGCAAATTTGAGCTTGGCGTCGGCGGCAAAACGGCTCTTGTCGTGGGGTCGCTCAATGTG
TGGATGCTTCTCATGACAGCTATTTACTTTCACACGTGGTTCGAAAAGCTTACTGGGCTCGTGACAGCGTTGGTG
GCGGTATATGCCGTATACATCGTGCCGCGCTTCATGCCAGTCATCAGGGCTGTCTTGGCCCTACCTGGGATATAA
Transcript >OphauB2|3988
ATGGCCACCCAGTACCCAGGTGGCTCGCATAAAGCGATTGACAATGGTTCCAACAAAGCCTCTCCTTTAGCAACA
ATTCGTCCGCGCAACCCTCCCTACCTTCCGACGCGACTGGAACGCCTCGTGACAACCCTTTTTCCGGTTCTGCTC
GTCTTCGGAACCCTATTTTCCGTCATTTCTCCACAGACTCGCGGCGCAATTTACGACCCAAGCCAACAGGCTCAC
GCGCAAGACGCAGCCCTAGTCCCAAGCTACTTTGCCCGCAAATCCAACCTCTTCAACGTTGTGTTTGTGAAGCGC
GGCTGGGCCTGGACCTCCTTGGCGCTCCTGATTTTTACCGCATCGCACCCCAGCGTGACATCGCGGTCACGCGTG
GGTCTACGCTGGGCAGCCGTAACGGTATGCTGGATCCTGGTGACTCAATGGTGCTTTGGCGCACCAGTAATTGAT
CGCGGCTTTCGGTGGACTGGCGGGAGATGCGACATGGCTGAGAGAGAAATTTCACGAGGCGGAGCAGCAGAGGCT
GGCATGGCGGATGTACTCACCGCCATGGCGTGCAGGACAGCCGGCGGCCACTGGAGAGGCGGTCATGACATCTCG
GGACATGTCTTTCTGCTTGTTCTAAGCACTGCAATGCTTTTGCAAGAAGTAGGCTGGCCGCTGCTAAGATGGACA
GGTGCCACGGAGGAGCGAACTATCATCATGTCCGACGGAGCTGTCAAGGGCGCAGGCGTTGAGGCAAACATGGCT
CCTGGACGCGGGCGCGGCAAATTTGAGCTTGGCGTCGGCGGCAAAACGGCTCTTGTCGTGGGGTCGCTCAATGTG
TGGATGCTTCTCATGACAGCTATTTACTTTCACACGTGGTTCGAAAAGCTTACTGGGCTCGTGACAGCGTTGGTG
GCGGTATATGCCGTATACATCGTGCCGCGCTTCATGCCAGTCATCAGGGCTGTCTTGGCCCTACCTGGGATATAA
Gene >OphauB2|3988
ATGGCCACCCAGTACCCAGGTGGCTCGCATAAAGCGATTGACAATGGTTCCAACAAAGCCTCTCCTTTAGCAACA
ATTCGTCCGCGCAACCCTCCCTACCTTCCGACGCGACTGGAACGCCTCGTGACAACCCTTTTTCCGGTTCTGCTC
GTCTTCGGAACCCTATTTTCCGTCATTTCTCCACAGACTCGCGGCGCAATTTACGACCCAAGCCAACAGGCTCAC
GCGCAAGACGCAGCCCTAGTCCCAAGCTACTTTGCCCGCAAATCCAACCTCTTCAACGTTGTGTTTGTGAAGCGC
GGCTGGGCCTGGACCTCCTTGGCGCTCCTGATTTTTACCGCATCGCACCCCAGCGTGACATCGCGGTCACGCGTG
GGTCTACGCTGGGCAGCCGTAACGGTATGCTGGATCCTGGTGACTCAATGGTGCTTTGGCGCACCAGTAATTGAT
CGCGGCTTTCGGTGGACTGGCGGGAGATGCGACATGGCTGAGAGAGAAATTTCACGAGGCGGAGCAGCAGAGGCT
GGCATGGCGGATGTACTCACCGCCATGGCGTGCAGGACAGCCGGCGGCCACTGGAGAGGCGGTCATGACATCTCG
GGACATGTCTTTCTGCTTGTTCTAAGCACTGCAATGCTTTTGCAAGAAGTAGGCTGGCCGCTGCTAAGATGGACA
GGTGCCACGGAGGAGCGAACTATCATCATGTCCGACGGAGCTGTCAAGGGCGCAGGCGTTGAGGCAAACATGGCT
CCTGGACGCGGGCGCGGCAAATTTGAGCTTGGCGTCGGCGGCAAAACGGCTCTTGTCGTGGGGTCGCTCAATGTG
TGGATGCTTCTCATGACAGCTATTTACTTTCACACGTGGTTCGAAAAGGTTAGTTTTTGTCGCTCTCTATGGACC
AGTCGCATTCGCGGGGCTGCCAATGTCTCTGTGCTTAACTAATATAGTTTTTAGCTTACTGGGCTCGTGACAGCG
TTGGTGGCGGTATATGCCGTATACATCGTGCCGCGCTTCATGCCAGTCATCAGGGCTGTCTTGGCCCTACCTGGG
ATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail