© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|3978 |
| Gene name | |
| Location | Contig_259:9332..10640 |
| Strand | - |
| Gene length (bp) | 1308 |
| Transcript length (bp) | 1143 |
| Coding sequence length (bp) | 1143 |
| Protein length (aa) | 381 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF08498 | Sterol_MT_C | Sterol methyltransferase C-terminal | 8.9E-30 | 314 | 378 |
| PF08241 | Methyltransf_11 | Methyltransferase domain | 1.3E-21 | 134 | 230 |
| PF13649 | Methyltransf_25 | Methyltransferase domain | 3.2E-20 | 133 | 228 |
| PF13847 | Methyltransf_31 | Methyltransferase domain | 4.2E-19 | 128 | 232 |
| PF01209 | Ubie_methyltran | ubiE/COQ5 methyltransferase family | 8.2E-13 | 120 | 234 |
| PF13489 | Methyltransf_23 | Methyltransferase domain | 1.6E-12 | 127 | 282 |
| PF02353 | CMAS | Mycolic acid cyclopropane synthetase | 2.5E-12 | 80 | 256 |
| PF08242 | Methyltransf_12 | Methyltransferase domain | 1.0E-10 | 134 | 230 |
| PF01135 | PCMT | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) | 2.3E-04 | 123 | 228 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9P3R1|ERG6_NEUCR | Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 | 3 | 380 | 0.0E+00 |
| sp|Q6C2D9|ERG6_YARLI | Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 | 4 | 380 | 4.0E-158 |
| sp|L7IP31|ERG6_MAGOY | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 | 4 | 378 | 6.0E-158 |
| sp|P0CT10|ERG6_MAGO7 | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 | 4 | 378 | 6.0E-158 |
| sp|Q6BRB7|ERG6_DEBHA | Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 | 3 | 380 | 2.0E-155 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9P3R1|ERG6_NEUCR | Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 | 3 | 380 | 0.0E+00 |
| sp|Q6C2D9|ERG6_YARLI | Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 | 4 | 380 | 4.0E-158 |
| sp|L7IP31|ERG6_MAGOY | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 | 4 | 378 | 6.0E-158 |
| sp|P0CT10|ERG6_MAGO7 | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 | 4 | 378 | 6.0E-158 |
| sp|Q6BRB7|ERG6_DEBHA | Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 | 3 | 380 | 2.0E-155 |
| sp|Q875K1|ERG6_CLAL4 | Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 | 4 | 380 | 1.0E-149 |
| sp|O74198|ERG6_CANAL | Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 | 4 | 378 | 1.0E-147 |
| sp|Q96WX4|ERG6_PNECA | Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 | 5 | 378 | 1.0E-143 |
| sp|O14321|ERG6_SCHPO | Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 | 16 | 378 | 5.0E-141 |
| sp|Q759S7|ERG6_ASHGO | Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 | 9 | 378 | 1.0E-137 |
| sp|Q6FRZ7|ERG6_CANGA | Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 | 9 | 380 | 4.0E-134 |
| sp|P25087|ERG6_YEAST | Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 | 9 | 380 | 2.0E-133 |
| sp|Q6CYB3|ERG6_KLULA | Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 | 10 | 378 | 1.0E-132 |
| sp|Q9LM02|SMT1_ARATH | Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 | 72 | 378 | 6.0E-99 |
| sp|Q6ZIX2|SMT1_ORYSJ | Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 | 71 | 378 | 4.0E-98 |
| sp|Q54I98|SMT1_DICDI | Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 | 71 | 379 | 5.0E-95 |
| sp|O82427|SMT2_ORYSJ | 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 | 27 | 379 | 3.0E-70 |
| sp|Q39227|SMT2_ARATH | 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 | 28 | 378 | 5.0E-70 |
| sp|Q94JS4|SMT3B_ARATH | 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 | 28 | 378 | 5.0E-70 |
| sp|H2E7T9|SMTL2_BOTBR | Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 | 75 | 378 | 1.0E-63 |
| sp|H2E7T7|BOMT_BOTBR | Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 | 75 | 378 | 4.0E-63 |
| sp|H2E7T5|SQMT1_BOTBR | Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 | 79 | 378 | 8.0E-61 |
| sp|H2E7T6|SQMT2_BOTBR | Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 | 51 | 378 | 1.0E-58 |
| sp|H2E7T8|SMTL1_BOTBR | Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 | 68 | 378 | 5.0E-58 |
| sp|H2E7U0|SMTL3_BOTBR | Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 | 79 | 378 | 3.0E-53 |
| sp|Q9TYP1|STRM1_CAEEL | Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 | 64 | 363 | 1.0E-33 |
| sp|Q8KZ94|REBMT_NOCAE | Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 | 64 | 288 | 4.0E-23 |
| sp|P74388|BQMT_SYNY3 | 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 | 90 | 235 | 4.0E-22 |
| sp|Q6ZIK0|GTOMC_ORYSJ | Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 | 84 | 299 | 7.0E-19 |
| sp|Q9ZSK1|GTOMC_ARATH | Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 | 83 | 266 | 6.0E-15 |
| sp|Q83WC3|SDMT_APHHA | Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 | 105 | 271 | 3.0E-14 |
| sp|Q9KJ20|GSDMT_ACTHA | Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 | 81 | 228 | 3.0E-13 |
| sp|Q9KJ21|SDMT_HALHR | Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 | 70 | 245 | 2.0E-12 |
| sp|Q9FR44|PEAM1_ARATH | Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 | 125 | 228 | 4.0E-11 |
| sp|Q9RMN9|MTF2_MYCS2 | Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 | 114 | 230 | 6.0E-11 |
| sp|Q7U4Z9|SDMT_SYNPX | Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 | 83 | 230 | 1.0E-10 |
| sp|Q944H0|PEAM2_ARATH | Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 | 125 | 228 | 2.0E-10 |
| sp|P67055|MENG_LISMO | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 | 125 | 228 | 6.0E-10 |
| sp|Q71Y84|MENG_LISMF | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 | 125 | 228 | 6.0E-10 |
| sp|C1KWN1|MENG_LISMC | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 | 125 | 228 | 6.0E-10 |
| sp|P67056|MENG_LISIN | Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 | 125 | 228 | 6.0E-10 |
| sp|A0AK43|MENG_LISW6 | Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 | 125 | 228 | 6.0E-10 |
| sp|A4F7P5|ERYG_SACEN | Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 | 119 | 239 | 9.0E-10 |
| sp|Q9C6B9|PEAM3_ARATH | Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 | 125 | 228 | 9.0E-10 |
| sp|B8DBZ5|MENG_LISMH | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 | 125 | 228 | 9.0E-10 |
| sp|Q74LY0|MENG_LACJO | Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 | 134 | 234 | 2.0E-09 |
| sp|Q6GGU0|MENG_STAAR | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 | 125 | 229 | 3.0E-09 |
| sp|Q5KXU0|MENG_GEOKA | Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 | 125 | 229 | 3.0E-09 |
| sp|P64842|Y1440_MYCBO | Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 | 121 | 235 | 4.0E-09 |
| sp|P9WLY7|Y1405_MYCTU | Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 | 121 | 235 | 4.0E-09 |
| sp|P9WLY6|Y1405_MYCTO | Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 | 121 | 235 | 4.0E-09 |
| sp|A9MCZ2|UBIE_BRUC2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 | 130 | 230 | 4.0E-09 |
| sp|Q8FUZ3|UBIE_BRUSU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 | 130 | 230 | 4.0E-09 |
| sp|O86169|MENG_GEOSE | Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 | 125 | 229 | 5.0E-09 |
| sp|P9WIN3|PHMT_MYCTU | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2952 PE=1 SV=1 | 130 | 230 | 8.0E-09 |
| sp|P9WIN2|PHMT_MYCTO | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3026 PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|A5U6W0|PHMT_MYCTA | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2979 PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|A1KMU6|PHMT_MYCBP | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2973 PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|Q7TXK3|PHMT_MYCBO | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2976 PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|Q8YDE4|UBIE_BRUME | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|C0RMK3|UBIE_BRUMB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|Q576Q0|UBIE_BRUAB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|Q2YJM4|UBIE_BRUA2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|B2SC50|UBIE_BRUA1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 | 130 | 230 | 8.0E-09 |
| sp|Q24W96|MENG_DESHY | Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 | 128 | 229 | 9.0E-09 |
| sp|Q8CSH9|MENG_STAES | Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 | 103 | 229 | 2.0E-08 |
| sp|Q5HP74|MENG_STAEQ | Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 | 103 | 229 | 2.0E-08 |
| sp|A0PQ29|PHMT2_MYCUA | Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2009 PE=3 SV=1 | 130 | 230 | 2.0E-08 |
| sp|A0PQX0|PHMT1_MYCUA | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 | 130 | 228 | 2.0E-08 |
| sp|P67063|MENG_STAAW | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|A8Z450|MENG_STAAT | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|Q6G992|MENG_STAAS | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|P67062|MENG_STAAN | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 | 125 | 229 | 4.0E-08 |
| sp|P67061|MENG_STAAM | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|A6QH20|MENG_STAAE | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|Q5HFV2|MENG_STAAC | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|A5ISZ9|MENG_STAA9 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|A6U1T9|MENG_STAA2 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|A7X2H6|MENG_STAA1 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 | 125 | 229 | 4.0E-08 |
| sp|A9ILA7|UBIE_BART1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiE PE=3 SV=1 | 133 | 235 | 4.0E-08 |
| sp|Q108P1|TNMT_PAPSO | (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 | 68 | 220 | 4.0E-08 |
| sp|A6WYI0|UBIE_OCHA4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 | 130 | 230 | 5.0E-08 |
| sp|Q9M571|PEAMT_SPIOL | Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 | 125 | 228 | 5.0E-08 |
| sp|Q88SI6|MENG_LACPL | Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 | 113 | 240 | 6.0E-08 |
| sp|Q2YY85|MENG_STAAB | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 | 125 | 229 | 7.0E-08 |
| sp|O66128|MENG_MICLU | Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 | 120 | 234 | 8.0E-08 |
| sp|Q5QYG2|UBIE_IDILO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 | 118 | 235 | 8.0E-08 |
| sp|C3SBU5|TNMT1_PAPBR | (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 | 68 | 220 | 8.0E-08 |
| sp|Q1QS47|UBIE_NITHX | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ubiE PE=3 SV=1 | 133 | 239 | 1.0E-07 |
| sp|Q9CD86|PHMT_MYCLE | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium leprae (strain TN) GN=ML0130 PE=3 SV=1 | 119 | 228 | 1.0E-07 |
| sp|C5D3E5|MENG_GEOSW | Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 | 125 | 228 | 1.0E-07 |
| sp|A9WW74|UBIE_BRUSI | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 | 130 | 230 | 1.0E-07 |
| sp|Q6G577|UBIE_BARHE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiE PE=3 SV=1 | 133 | 235 | 1.0E-07 |
| sp|P67064|MENG_TROWT | Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 | 125 | 235 | 1.0E-07 |
| sp|P67065|MENG_TROW8 | Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 | 125 | 235 | 1.0E-07 |
| sp|A4XPM7|UBIE_PSEMY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 | 42 | 235 | 2.0E-07 |
| sp|P31113|MENG_BACSU | Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 | 124 | 228 | 2.0E-07 |
| sp|Q3T131|COQ3_BOVIN | Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Bos taurus GN=COQ3 PE=2 SV=1 | 130 | 228 | 3.0E-07 |
| sp|A7Z627|MENG_BACMF | Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 | 123 | 228 | 3.0E-07 |
| sp|Q6G1I2|UBIE_BARQU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella quintana (strain Toulouse) GN=ubiE PE=3 SV=1 | 133 | 235 | 3.0E-07 |
| sp|C3SBU4|TNMT2_PAPBR | Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 | 68 | 220 | 4.0E-07 |
| sp|B3Q619|UBIE_RHOPT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain TIE-1) GN=ubiE PE=3 SV=1 | 133 | 239 | 4.0E-07 |
| sp|Q6NDM2|UBIE_RHOPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ubiE PE=3 SV=1 | 133 | 239 | 4.0E-07 |
| sp|Q9KCC4|MENG_BACHD | Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 | 125 | 228 | 5.0E-07 |
| sp|Q8CWG0|MENG_OCEIH | Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 | 125 | 228 | 5.0E-07 |
| sp|A8FEK9|MENG_BACP2 | Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 | 125 | 229 | 6.0E-07 |
| sp|A8ACY2|UBIE_CITK8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 | 118 | 235 | 6.0E-07 |
| sp|Q9CMI6|UBIG_PASMU | Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 | 108 | 230 | 7.0E-07 |
| sp|B7GHP8|MENG_ANOFW | Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 | 100 | 228 | 7.0E-07 |
| sp|Q3K8T6|UBIG_PSEPF | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 | 103 | 228 | 9.0E-07 |
| sp|Q67LE6|MENG_SYMTH | Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 | 117 | 230 | 9.0E-07 |
| sp|Q98GV1|UBIE_RHILO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 | 128 | 230 | 9.0E-07 |
| sp|Q88D17|UBIE_PSEPK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 | 127 | 242 | 1.0E-06 |
| sp|A5WA45|UBIE_PSEP1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 | 127 | 242 | 1.0E-06 |
| sp|Q63159|COQ3_RAT | Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Rattus norvegicus GN=Coq3 PE=2 SV=2 | 130 | 228 | 1.0E-06 |
| sp|Q4K8M4|UBIG_PSEF5 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 | 130 | 228 | 1.0E-06 |
| sp|C3K6J1|UBIG_PSEFS | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 | 103 | 228 | 2.0E-06 |
| sp|A1UUE1|UBIE_BARBK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ubiE PE=3 SV=1 | 129 | 235 | 2.0E-06 |
| sp|Q89WD0|UBIE_BRADU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ubiE PE=3 SV=1 | 133 | 247 | 2.0E-06 |
| sp|Q8A005|MENG_BACTN | Demethylmenaquinone methyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=menG PE=3 SV=1 | 132 | 241 | 2.0E-06 |
| sp|A6UFF7|UBIE_SINMW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Sinorhizobium medicae (strain WSM419) GN=ubiE PE=3 SV=1 | 128 | 235 | 2.0E-06 |
| sp|Q0AA73|UBIG_ALKEH | Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 | 120 | 228 | 2.0E-06 |
| sp|P49016|MENG_LACLA | Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 | 130 | 228 | 2.0E-06 |
| sp|O31474|YCGJ_BACSU | Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 | 133 | 245 | 2.0E-06 |
| sp|Q57060|Y095_HAEIN | Uncharacterized protein HI_0095 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0095 PE=4 SV=1 | 133 | 238 | 2.0E-06 |
| sp|Q65I24|MENG_BACLD | Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 | 123 | 228 | 3.0E-06 |
| sp|B9J7S8|UBIE_AGRRK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ubiE PE=3 SV=1 | 133 | 239 | 3.0E-06 |
| sp|A7MQL7|UBIE_CROS8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 | 118 | 235 | 3.0E-06 |
| sp|A9MIY3|UBIE_SALAR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 | 118 | 280 | 3.0E-06 |
| sp|A5E888|UBIE_BRASB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ubiE PE=3 SV=1 | 133 | 247 | 3.0E-06 |
| sp|C3MCY6|UBIE_RHISN | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium sp. (strain NGR234) GN=ubiE PE=3 SV=1 | 128 | 235 | 4.0E-06 |
| sp|Q0AME1|UBIG_MARMM | Ubiquinone biosynthesis O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=ubiG PE=3 SV=1 | 129 | 230 | 4.0E-06 |
| sp|Q8UIH5|UBIE_AGRFC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ubiE PE=3 SV=1 | 133 | 239 | 4.0E-06 |
| sp|B3H0C8|UBIG_ACTP7 | Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 | 130 | 230 | 4.0E-06 |
| sp|Q0WPT7|Y2104_ARATH | Uncharacterized methyltransferase At2g41040, chloroplastic OS=Arabidopsis thaliana GN=At2g41040 PE=2 SV=1 | 86 | 230 | 4.0E-06 |
| sp|A3MZ07|UBIG_ACTP2 | Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 | 130 | 230 | 5.0E-06 |
| sp|Q1GC56|UBIE_RUEST | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 | 128 | 247 | 5.0E-06 |
| sp|Q49XS5|MENG_STAS1 | Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 | 125 | 234 | 5.0E-06 |
| sp|Q1IDA6|UBIG_PSEE4 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 | 130 | 228 | 5.0E-06 |
| sp|P0A2K5|UBIE_SALTY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|P0A2K6|UBIE_SALTI | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B4TNX9|UBIE_SALSV | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B5BIX9|UBIE_SALPK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|C0Q3E1|UBIE_SALPC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|A9MY97|UBIE_SALPB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|Q5PKP4|UBIE_SALPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B4SZ73|UBIE_SALNS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B4TBR3|UBIE_SALHS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B5RFM8|UBIE_SALG2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B5QW73|UBIE_SALEP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B5FNW6|UBIE_SALDC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|Q57HN8|UBIE_SALCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|B5EZU8|UBIE_SALA4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|A8G8B8|UBIE_SERP5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 | 118 | 235 | 5.0E-06 |
| sp|Q4FVG3|UBIG_PSYA2 | Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 | 130 | 229 | 5.0E-06 |
| sp|Q92SK7|UBIE_RHIME | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium meliloti (strain 1021) GN=ubiE PE=3 SV=2 | 128 | 235 | 7.0E-06 |
| sp|A4YJH0|UBIE_BRASO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain ORS278) GN=ubiE PE=3 SV=1 | 133 | 235 | 8.0E-06 |
| sp|B5ZRR7|UBIG_RHILW | Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ubiG PE=3 SV=1 | 129 | 232 | 8.0E-06 |
| sp|Q13EN8|UBIE_RHOPS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain BisB5) GN=ubiE PE=3 SV=1 | 133 | 239 | 8.0E-06 |
| sp|B5XNZ3|UBIG_KLEP3 | Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=ubiG PE=3 SV=1 | 130 | 228 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006694 | steroid biosynthetic process | Yes |
| GO:0008168 | methyltransferase activity | Yes |
| GO:0008152 | metabolic process | No |
| GO:0016741 | transferase activity, transferring one-carbon groups | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0008610 | lipid biosynthetic process | No |
| GO:0016740 | transferase activity | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0003824 | catalytic activity | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0008202 | steroid metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0006629 | lipid metabolic process | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0009058 | biosynthetic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 45 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|3978 MAPSALNLEQEDHSRDAAFNKAMHGKSAQARGGIAAMFSKGSEAKQAACEEYFKHWDNKLAADETPEERAARTAE YATLTRHYYNLATDLYEYGWGQCFHFCRFSKSEPFYQAIARHEHYLAHCMNIQEGMNVLDVGCGVGGPAREIAKF TGANITGLNNNDYQIERATHYAAKEGLSDQVKFVKGDFMQMSFKDNSFDAVYAIEATVHAPTLEGIYREIFRVLK PGGVFGVYEWLMTDQYDNDDLHHREIRLGIEQGNGISNMCKIAEALDAMRAAGFELLRNEDLAERPDALPWYWPL SGDLRYLQSVGDIFTILRLTRWGRTVAHNLAGALEMLRLAPAGTKKTADSLAFAADCLVAGGREHLFTPMYLMVG RKPAN* |
| Coding | >OphauB2|3978 ATGGCTCCCTCTGCATTAAACCTCGAACAAGAGGACCACAGCCGCGATGCTGCCTTCAACAAGGCCATGCATGGC AAGTCGGCACAGGCGCGTGGTGGAATTGCGGCCATGTTTAGCAAGGGCTCAGAAGCCAAGCAAGCGGCTTGTGAG GAATACTTTAAGCATTGGGACAATAAACTGGCGGCCGATGAGACGCCCGAGGAGAGAGCTGCACGAACTGCCGAA TATGCCACCTTGACGAGGCACTACTACAACCTCGCGACAGACTTGTACGAATATGGCTGGGGCCAGTGCTTTCAC TTTTGTCGCTTTTCCAAATCTGAACCCTTTTACCAAGCCATTGCCCGTCATGAGCACTATCTCGCCCACTGCATG AATATACAAGAGGGCATGAATGTTCTCGATGTTGGCTGCGGCGTGGGAGGCCCAGCTCGTGAAATTGCAAAGTTT ACCGGCGCAAACATCACCGGCCTTAACAATAACGACTATCAGATTGAGCGCGCCACCCACTACGCGGCAAAAGAA GGCCTATCCGACCAAGTCAAGTTTGTCAAGGGCGACTTTATGCAAATGTCATTCAAAGACAACTCGTTTGACGCC GTCTACGCCATTGAGGCTACCGTTCACGCGCCCACTCTCGAGGGTATCTACCGCGAGATTTTCCGTGTTCTCAAG CCCGGAGGCGTCTTTGGCGTCTACGAGTGGCTCATGACGGACCAGTACGACAATGATGATCTGCACCATCGCGAG ATTCGACTCGGCATTGAGCAGGGCAACGGCATTTCCAACATGTGCAAGATTGCCGAGGCTCTCGATGCCATGCGC GCCGCTGGCTTTGAGCTGCTGCGCAACGAGGATCTCGCCGAGCGGCCTGATGCCTTGCCGTGGTACTGGCCCTTG TCTGGCGACTTGCGCTATCTTCAGTCGGTCGGTGACATTTTTACTATTTTGCGCTTGACGCGCTGGGGGCGCACA GTAGCGCATAATCTTGCTGGTGCGCTCGAGATGCTCAGGTTGGCGCCAGCCGGCACCAAGAAGACGGCAGATAGT CTGGCATTTGCAGCAGACTGTCTGGTTGCCGGTGGCCGAGAACATCTTTTTACCCCCATGTACCTCATGGTTGGC CGCAAGCCAGCAAATTAA |
| Transcript | >OphauB2|3978 ATGGCTCCCTCTGCATTAAACCTCGAACAAGAGGACCACAGCCGCGATGCTGCCTTCAACAAGGCCATGCATGGC AAGTCGGCACAGGCGCGTGGTGGAATTGCGGCCATGTTTAGCAAGGGCTCAGAAGCCAAGCAAGCGGCTTGTGAG GAATACTTTAAGCATTGGGACAATAAACTGGCGGCCGATGAGACGCCCGAGGAGAGAGCTGCACGAACTGCCGAA TATGCCACCTTGACGAGGCACTACTACAACCTCGCGACAGACTTGTACGAATATGGCTGGGGCCAGTGCTTTCAC TTTTGTCGCTTTTCCAAATCTGAACCCTTTTACCAAGCCATTGCCCGTCATGAGCACTATCTCGCCCACTGCATG AATATACAAGAGGGCATGAATGTTCTCGATGTTGGCTGCGGCGTGGGAGGCCCAGCTCGTGAAATTGCAAAGTTT ACCGGCGCAAACATCACCGGCCTTAACAATAACGACTATCAGATTGAGCGCGCCACCCACTACGCGGCAAAAGAA GGCCTATCCGACCAAGTCAAGTTTGTCAAGGGCGACTTTATGCAAATGTCATTCAAAGACAACTCGTTTGACGCC GTCTACGCCATTGAGGCTACCGTTCACGCGCCCACTCTCGAGGGTATCTACCGCGAGATTTTCCGTGTTCTCAAG CCCGGAGGCGTCTTTGGCGTCTACGAGTGGCTCATGACGGACCAGTACGACAATGATGATCTGCACCATCGCGAG ATTCGACTCGGCATTGAGCAGGGCAACGGCATTTCCAACATGTGCAAGATTGCCGAGGCTCTCGATGCCATGCGC GCCGCTGGCTTTGAGCTGCTGCGCAACGAGGATCTCGCCGAGCGGCCTGATGCCTTGCCGTGGTACTGGCCCTTG TCTGGCGACTTGCGCTATCTTCAGTCGGTCGGTGACATTTTTACTATTTTGCGCTTGACGCGCTGGGGGCGCACA GTAGCGCATAATCTTGCTGGTGCGCTCGAGATGCTCAGGTTGGCGCCAGCCGGCACCAAGAAGACGGCAGATAGT CTGGCATTTGCAGCAGACTGTCTGGTTGCCGGTGGCCGAGAACATCTTTTTACCCCCATGTACCTCATGGTTGGC CGCAAGCCAGCAAATTAA |
| Gene | >OphauB2|3978 ATGGCTCCCTCTGCATTAAACCTCGAACAAGAGGACCACAGCCGCGATGCTGCCTTCAACAAGGCCATGCATGGC AAGTCGGCACAGGCGCGTGGTGGAATTGCGGCCATGTTTAGCAAGGGCTCAGAAGCCAAGCAAGCGGCTTGTGAG GAATACTTTAAGCATTGGGACAATAAACTGGCGGCCGATGAGACGCCCGAGGAGAGAGCTGTAAGCCGCTTACGC TCGGCTGTTACCAAAGTATATGCTGATTGCAATCCTAGGCACGAACTGCCGAATATGCCACCTTGACGAGGCAGT GAGTGTCTTTTTTTTTTTTTTCGACTTGTTCTTTTTCGACGTCTGACTTGCTCTTAGCTACTACAACCTCGCGAC AGACTTGTACGAATATGGCTGGGGCCAGTGCTTTCACTTTTGTCGCTTTTCCAAATCTGAACCCTTTTACCAAGC CATTGCCCGTCATGAGCACTATCTCGCCCACTGCATGAATATACAAGAGGGCATGAATGTTCTCGATGTTGGCTG CGGCGTGGGAGGCCCAGCTCGTGAAATTGCAAAGTTTACCGGCGCAAACATCACCGGCCTTAACAATAACGACTA TCAGATTGAGCGCGCCACCCACTACGCGGCAAAAGAAGGCCTATCCGACCAAGTCAAGTTTGTCAAGGGCGACTT TATGGTGAGCAAGACGCACGCCGTCATTTTGTTGCCCACGGCTCACCCTGTTGGCAGCAAATGTCATTCAAAGAC AACTCGTTTGACGCCGTCTACGCCATTGAGGCTACCGTTCACGCGCCCACTCTCGAGGGTATCTACCGCGAGATT TTCCGTGTTCTCAAGCCCGGAGGCGTCTTTGGCGTCTACGAGTGGCTCATGACGGACCAGTACGACAATGATGAT CTGCACCATCGCGAGATTCGACTCGGCATTGAGCAGGGCAACGGCATTTCCAACATGTGCAAGATTGCCGAGGCT CTCGATGCCATGCGCGCCGCTGGCTTTGAGCTGCTGCGCAACGAGGATCTCGCCGAGCGGCCTGATGCCTTGCCG TGGTACTGGCCCTTGTCTGGCGACTTGCGCTATCTTCAGTCGGTCGGTGACATTTTTACTATTTTGCGCTTGACG CGCTGGGGGCGCACAGTAGCGCATAATCTTGCTGGTGCGCTCGAGATGCTCAGGTTGGCGCCAGCCGGCACCAAG AAGACGGCAGATAGTCTGGCATTTGCAGCAGACTGTCTGGTTGCCGGTGGCCGAGAACATCTTTTTACCCCCATG TACCTCATGGTTGGCCGCAAGCCAGCAAATTAA |