Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3978
Gene name
LocationContig_259:9332..10640
Strand-
Gene length (bp)1308
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08498 Sterol_MT_C Sterol methyltransferase C-terminal 8.9E-30 314 378
PF08241 Methyltransf_11 Methyltransferase domain 1.3E-21 134 230
PF13649 Methyltransf_25 Methyltransferase domain 3.2E-20 133 228
PF13847 Methyltransf_31 Methyltransferase domain 4.2E-19 128 232
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 8.2E-13 120 234
PF13489 Methyltransf_23 Methyltransferase domain 1.6E-12 127 282
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.5E-12 80 256
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-10 134 230
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 2.3E-04 123 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 3 380 0.0E+00
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 4 380 4.0E-158
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 4 378 6.0E-158
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 4 378 6.0E-158
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 3 380 2.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 3 380 0.0E+00
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 4 380 4.0E-158
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 4 378 6.0E-158
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 4 378 6.0E-158
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 3 380 2.0E-155
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 4 380 1.0E-149
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 4 378 1.0E-147
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 5 378 1.0E-143
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 16 378 5.0E-141
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 9 378 1.0E-137
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 9 380 4.0E-134
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 9 380 2.0E-133
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 10 378 1.0E-132
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 72 378 6.0E-99
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 71 378 4.0E-98
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 71 379 5.0E-95
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 27 379 3.0E-70
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 28 378 5.0E-70
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 28 378 5.0E-70
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 75 378 1.0E-63
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 75 378 4.0E-63
sp|H2E7T5|SQMT1_BOTBR Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 79 378 8.0E-61
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 51 378 1.0E-58
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 68 378 5.0E-58
sp|H2E7U0|SMTL3_BOTBR Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 79 378 3.0E-53
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 64 363 1.0E-33
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 64 288 4.0E-23
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 90 235 4.0E-22
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 84 299 7.0E-19
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 83 266 6.0E-15
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 105 271 3.0E-14
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 81 228 3.0E-13
sp|Q9KJ21|SDMT_HALHR Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 70 245 2.0E-12
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 125 228 4.0E-11
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 114 230 6.0E-11
sp|Q7U4Z9|SDMT_SYNPX Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 83 230 1.0E-10
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 125 228 2.0E-10
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 125 228 6.0E-10
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 119 239 9.0E-10
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 125 228 9.0E-10
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 125 228 9.0E-10
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 134 234 2.0E-09
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 125 229 3.0E-09
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 125 229 3.0E-09
sp|P64842|Y1440_MYCBO Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 121 235 4.0E-09
sp|P9WLY7|Y1405_MYCTU Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 121 235 4.0E-09
sp|P9WLY6|Y1405_MYCTO Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 121 235 4.0E-09
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 130 230 4.0E-09
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 130 230 4.0E-09
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 125 229 5.0E-09
sp|P9WIN3|PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2952 PE=1 SV=1 130 230 8.0E-09
sp|P9WIN2|PHMT_MYCTO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3026 PE=3 SV=1 130 230 8.0E-09
sp|A5U6W0|PHMT_MYCTA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2979 PE=3 SV=1 130 230 8.0E-09
sp|A1KMU6|PHMT_MYCBP Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2973 PE=3 SV=1 130 230 8.0E-09
sp|Q7TXK3|PHMT_MYCBO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2976 PE=3 SV=1 130 230 8.0E-09
sp|Q8YDE4|UBIE_BRUME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 130 230 8.0E-09
sp|C0RMK3|UBIE_BRUMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 130 230 8.0E-09
sp|Q576Q0|UBIE_BRUAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 130 230 8.0E-09
sp|Q2YJM4|UBIE_BRUA2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 130 230 8.0E-09
sp|B2SC50|UBIE_BRUA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 130 230 8.0E-09
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 128 229 9.0E-09
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 103 229 2.0E-08
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 103 229 2.0E-08
sp|A0PQ29|PHMT2_MYCUA Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2009 PE=3 SV=1 130 230 2.0E-08
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 130 228 2.0E-08
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 125 229 4.0E-08
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 125 229 4.0E-08
sp|A9ILA7|UBIE_BART1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiE PE=3 SV=1 133 235 4.0E-08
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 68 220 4.0E-08
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 130 230 5.0E-08
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 125 228 5.0E-08
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 113 240 6.0E-08
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 125 229 7.0E-08
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 120 234 8.0E-08
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 118 235 8.0E-08
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 68 220 8.0E-08
sp|Q1QS47|UBIE_NITHX Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ubiE PE=3 SV=1 133 239 1.0E-07
sp|Q9CD86|PHMT_MYCLE Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium leprae (strain TN) GN=ML0130 PE=3 SV=1 119 228 1.0E-07
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 125 228 1.0E-07
sp|A9WW74|UBIE_BRUSI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 130 230 1.0E-07
sp|Q6G577|UBIE_BARHE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiE PE=3 SV=1 133 235 1.0E-07
sp|P67064|MENG_TROWT Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 125 235 1.0E-07
sp|P67065|MENG_TROW8 Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 125 235 1.0E-07
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 42 235 2.0E-07
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 124 228 2.0E-07
sp|Q3T131|COQ3_BOVIN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Bos taurus GN=COQ3 PE=2 SV=1 130 228 3.0E-07
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 123 228 3.0E-07
sp|Q6G1I2|UBIE_BARQU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella quintana (strain Toulouse) GN=ubiE PE=3 SV=1 133 235 3.0E-07
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 68 220 4.0E-07
sp|B3Q619|UBIE_RHOPT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain TIE-1) GN=ubiE PE=3 SV=1 133 239 4.0E-07
sp|Q6NDM2|UBIE_RHOPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ubiE PE=3 SV=1 133 239 4.0E-07
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 125 228 5.0E-07
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 125 228 5.0E-07
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 125 229 6.0E-07
sp|A8ACY2|UBIE_CITK8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 118 235 6.0E-07
sp|Q9CMI6|UBIG_PASMU Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 108 230 7.0E-07
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 100 228 7.0E-07
sp|Q3K8T6|UBIG_PSEPF Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 103 228 9.0E-07
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 117 230 9.0E-07
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 128 230 9.0E-07
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 127 242 1.0E-06
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 127 242 1.0E-06
sp|Q63159|COQ3_RAT Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Rattus norvegicus GN=Coq3 PE=2 SV=2 130 228 1.0E-06
sp|Q4K8M4|UBIG_PSEF5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 130 228 1.0E-06
sp|C3K6J1|UBIG_PSEFS Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 103 228 2.0E-06
sp|A1UUE1|UBIE_BARBK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ubiE PE=3 SV=1 129 235 2.0E-06
sp|Q89WD0|UBIE_BRADU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ubiE PE=3 SV=1 133 247 2.0E-06
sp|Q8A005|MENG_BACTN Demethylmenaquinone methyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=menG PE=3 SV=1 132 241 2.0E-06
sp|A6UFF7|UBIE_SINMW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Sinorhizobium medicae (strain WSM419) GN=ubiE PE=3 SV=1 128 235 2.0E-06
sp|Q0AA73|UBIG_ALKEH Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 120 228 2.0E-06
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 130 228 2.0E-06
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 133 245 2.0E-06
sp|Q57060|Y095_HAEIN Uncharacterized protein HI_0095 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0095 PE=4 SV=1 133 238 2.0E-06
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 123 228 3.0E-06
sp|B9J7S8|UBIE_AGRRK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ubiE PE=3 SV=1 133 239 3.0E-06
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 118 235 3.0E-06
sp|A9MIY3|UBIE_SALAR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 118 280 3.0E-06
sp|A5E888|UBIE_BRASB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ubiE PE=3 SV=1 133 247 3.0E-06
sp|C3MCY6|UBIE_RHISN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium sp. (strain NGR234) GN=ubiE PE=3 SV=1 128 235 4.0E-06
sp|Q0AME1|UBIG_MARMM Ubiquinone biosynthesis O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=ubiG PE=3 SV=1 129 230 4.0E-06
sp|Q8UIH5|UBIE_AGRFC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ubiE PE=3 SV=1 133 239 4.0E-06
sp|B3H0C8|UBIG_ACTP7 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 130 230 4.0E-06
sp|Q0WPT7|Y2104_ARATH Uncharacterized methyltransferase At2g41040, chloroplastic OS=Arabidopsis thaliana GN=At2g41040 PE=2 SV=1 86 230 4.0E-06
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 130 230 5.0E-06
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 128 247 5.0E-06
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 125 234 5.0E-06
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 130 228 5.0E-06
sp|P0A2K5|UBIE_SALTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|P0A2K6|UBIE_SALTI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B4TNX9|UBIE_SALSV Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B5BIX9|UBIE_SALPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|C0Q3E1|UBIE_SALPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|A9MY97|UBIE_SALPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|Q5PKP4|UBIE_SALPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B4SZ73|UBIE_SALNS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B4TBR3|UBIE_SALHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B5RFM8|UBIE_SALG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B5QW73|UBIE_SALEP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B5FNW6|UBIE_SALDC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|Q57HN8|UBIE_SALCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|B5EZU8|UBIE_SALA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 118 235 5.0E-06
sp|Q4FVG3|UBIG_PSYA2 Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 130 229 5.0E-06
sp|Q92SK7|UBIE_RHIME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium meliloti (strain 1021) GN=ubiE PE=3 SV=2 128 235 7.0E-06
sp|A4YJH0|UBIE_BRASO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain ORS278) GN=ubiE PE=3 SV=1 133 235 8.0E-06
sp|B5ZRR7|UBIG_RHILW Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ubiG PE=3 SV=1 129 232 8.0E-06
sp|Q13EN8|UBIE_RHOPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain BisB5) GN=ubiE PE=3 SV=1 133 239 8.0E-06
sp|B5XNZ3|UBIG_KLEP3 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=ubiG PE=3 SV=1 130 228 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006694 steroid biosynthetic process Yes
GO:0008168 methyltransferase activity Yes
GO:0008152 metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:1901576 organic substance biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008202 steroid metabolic process No
GO:0003674 molecular_function No
GO:0006629 lipid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup762
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3684
Ophiocordyceps australis map64 (Brazil) OphauB2|3978 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02959
Ophiocordyceps camponoti-rufipedis Ophun1|6301
Ophiocordyceps kimflemingae Ophio5|6915
Ophiocordyceps kimflemingae Ophio5|7799
Ophiocordyceps subramaniannii Hirsu2|2555

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3978
MAPSALNLEQEDHSRDAAFNKAMHGKSAQARGGIAAMFSKGSEAKQAACEEYFKHWDNKLAADETPEERAARTAE
YATLTRHYYNLATDLYEYGWGQCFHFCRFSKSEPFYQAIARHEHYLAHCMNIQEGMNVLDVGCGVGGPAREIAKF
TGANITGLNNNDYQIERATHYAAKEGLSDQVKFVKGDFMQMSFKDNSFDAVYAIEATVHAPTLEGIYREIFRVLK
PGGVFGVYEWLMTDQYDNDDLHHREIRLGIEQGNGISNMCKIAEALDAMRAAGFELLRNEDLAERPDALPWYWPL
SGDLRYLQSVGDIFTILRLTRWGRTVAHNLAGALEMLRLAPAGTKKTADSLAFAADCLVAGGREHLFTPMYLMVG
RKPAN*
Coding >OphauB2|3978
ATGGCTCCCTCTGCATTAAACCTCGAACAAGAGGACCACAGCCGCGATGCTGCCTTCAACAAGGCCATGCATGGC
AAGTCGGCACAGGCGCGTGGTGGAATTGCGGCCATGTTTAGCAAGGGCTCAGAAGCCAAGCAAGCGGCTTGTGAG
GAATACTTTAAGCATTGGGACAATAAACTGGCGGCCGATGAGACGCCCGAGGAGAGAGCTGCACGAACTGCCGAA
TATGCCACCTTGACGAGGCACTACTACAACCTCGCGACAGACTTGTACGAATATGGCTGGGGCCAGTGCTTTCAC
TTTTGTCGCTTTTCCAAATCTGAACCCTTTTACCAAGCCATTGCCCGTCATGAGCACTATCTCGCCCACTGCATG
AATATACAAGAGGGCATGAATGTTCTCGATGTTGGCTGCGGCGTGGGAGGCCCAGCTCGTGAAATTGCAAAGTTT
ACCGGCGCAAACATCACCGGCCTTAACAATAACGACTATCAGATTGAGCGCGCCACCCACTACGCGGCAAAAGAA
GGCCTATCCGACCAAGTCAAGTTTGTCAAGGGCGACTTTATGCAAATGTCATTCAAAGACAACTCGTTTGACGCC
GTCTACGCCATTGAGGCTACCGTTCACGCGCCCACTCTCGAGGGTATCTACCGCGAGATTTTCCGTGTTCTCAAG
CCCGGAGGCGTCTTTGGCGTCTACGAGTGGCTCATGACGGACCAGTACGACAATGATGATCTGCACCATCGCGAG
ATTCGACTCGGCATTGAGCAGGGCAACGGCATTTCCAACATGTGCAAGATTGCCGAGGCTCTCGATGCCATGCGC
GCCGCTGGCTTTGAGCTGCTGCGCAACGAGGATCTCGCCGAGCGGCCTGATGCCTTGCCGTGGTACTGGCCCTTG
TCTGGCGACTTGCGCTATCTTCAGTCGGTCGGTGACATTTTTACTATTTTGCGCTTGACGCGCTGGGGGCGCACA
GTAGCGCATAATCTTGCTGGTGCGCTCGAGATGCTCAGGTTGGCGCCAGCCGGCACCAAGAAGACGGCAGATAGT
CTGGCATTTGCAGCAGACTGTCTGGTTGCCGGTGGCCGAGAACATCTTTTTACCCCCATGTACCTCATGGTTGGC
CGCAAGCCAGCAAATTAA
Transcript >OphauB2|3978
ATGGCTCCCTCTGCATTAAACCTCGAACAAGAGGACCACAGCCGCGATGCTGCCTTCAACAAGGCCATGCATGGC
AAGTCGGCACAGGCGCGTGGTGGAATTGCGGCCATGTTTAGCAAGGGCTCAGAAGCCAAGCAAGCGGCTTGTGAG
GAATACTTTAAGCATTGGGACAATAAACTGGCGGCCGATGAGACGCCCGAGGAGAGAGCTGCACGAACTGCCGAA
TATGCCACCTTGACGAGGCACTACTACAACCTCGCGACAGACTTGTACGAATATGGCTGGGGCCAGTGCTTTCAC
TTTTGTCGCTTTTCCAAATCTGAACCCTTTTACCAAGCCATTGCCCGTCATGAGCACTATCTCGCCCACTGCATG
AATATACAAGAGGGCATGAATGTTCTCGATGTTGGCTGCGGCGTGGGAGGCCCAGCTCGTGAAATTGCAAAGTTT
ACCGGCGCAAACATCACCGGCCTTAACAATAACGACTATCAGATTGAGCGCGCCACCCACTACGCGGCAAAAGAA
GGCCTATCCGACCAAGTCAAGTTTGTCAAGGGCGACTTTATGCAAATGTCATTCAAAGACAACTCGTTTGACGCC
GTCTACGCCATTGAGGCTACCGTTCACGCGCCCACTCTCGAGGGTATCTACCGCGAGATTTTCCGTGTTCTCAAG
CCCGGAGGCGTCTTTGGCGTCTACGAGTGGCTCATGACGGACCAGTACGACAATGATGATCTGCACCATCGCGAG
ATTCGACTCGGCATTGAGCAGGGCAACGGCATTTCCAACATGTGCAAGATTGCCGAGGCTCTCGATGCCATGCGC
GCCGCTGGCTTTGAGCTGCTGCGCAACGAGGATCTCGCCGAGCGGCCTGATGCCTTGCCGTGGTACTGGCCCTTG
TCTGGCGACTTGCGCTATCTTCAGTCGGTCGGTGACATTTTTACTATTTTGCGCTTGACGCGCTGGGGGCGCACA
GTAGCGCATAATCTTGCTGGTGCGCTCGAGATGCTCAGGTTGGCGCCAGCCGGCACCAAGAAGACGGCAGATAGT
CTGGCATTTGCAGCAGACTGTCTGGTTGCCGGTGGCCGAGAACATCTTTTTACCCCCATGTACCTCATGGTTGGC
CGCAAGCCAGCAAATTAA
Gene >OphauB2|3978
ATGGCTCCCTCTGCATTAAACCTCGAACAAGAGGACCACAGCCGCGATGCTGCCTTCAACAAGGCCATGCATGGC
AAGTCGGCACAGGCGCGTGGTGGAATTGCGGCCATGTTTAGCAAGGGCTCAGAAGCCAAGCAAGCGGCTTGTGAG
GAATACTTTAAGCATTGGGACAATAAACTGGCGGCCGATGAGACGCCCGAGGAGAGAGCTGTAAGCCGCTTACGC
TCGGCTGTTACCAAAGTATATGCTGATTGCAATCCTAGGCACGAACTGCCGAATATGCCACCTTGACGAGGCAGT
GAGTGTCTTTTTTTTTTTTTTCGACTTGTTCTTTTTCGACGTCTGACTTGCTCTTAGCTACTACAACCTCGCGAC
AGACTTGTACGAATATGGCTGGGGCCAGTGCTTTCACTTTTGTCGCTTTTCCAAATCTGAACCCTTTTACCAAGC
CATTGCCCGTCATGAGCACTATCTCGCCCACTGCATGAATATACAAGAGGGCATGAATGTTCTCGATGTTGGCTG
CGGCGTGGGAGGCCCAGCTCGTGAAATTGCAAAGTTTACCGGCGCAAACATCACCGGCCTTAACAATAACGACTA
TCAGATTGAGCGCGCCACCCACTACGCGGCAAAAGAAGGCCTATCCGACCAAGTCAAGTTTGTCAAGGGCGACTT
TATGGTGAGCAAGACGCACGCCGTCATTTTGTTGCCCACGGCTCACCCTGTTGGCAGCAAATGTCATTCAAAGAC
AACTCGTTTGACGCCGTCTACGCCATTGAGGCTACCGTTCACGCGCCCACTCTCGAGGGTATCTACCGCGAGATT
TTCCGTGTTCTCAAGCCCGGAGGCGTCTTTGGCGTCTACGAGTGGCTCATGACGGACCAGTACGACAATGATGAT
CTGCACCATCGCGAGATTCGACTCGGCATTGAGCAGGGCAACGGCATTTCCAACATGTGCAAGATTGCCGAGGCT
CTCGATGCCATGCGCGCCGCTGGCTTTGAGCTGCTGCGCAACGAGGATCTCGCCGAGCGGCCTGATGCCTTGCCG
TGGTACTGGCCCTTGTCTGGCGACTTGCGCTATCTTCAGTCGGTCGGTGACATTTTTACTATTTTGCGCTTGACG
CGCTGGGGGCGCACAGTAGCGCATAATCTTGCTGGTGCGCTCGAGATGCTCAGGTTGGCGCCAGCCGGCACCAAG
AAGACGGCAGATAGTCTGGCATTTGCAGCAGACTGTCTGGTTGCCGGTGGCCGAGAACATCTTTTTACCCCCATG
TACCTCATGGTTGGCCGCAAGCCAGCAAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail