Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|397
Gene name
LocationContig_104:44527..45148
Strand-
Gene length (bp)621
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05916 Sld5 GINS complex protein 1.4E-15 44 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA5|PSF3_GIBZE DNA replication complex GINS protein PSF3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PSF3 PE=3 SV=1 1 180 4.0E-91
sp|Q7S432|PSF3_NEUCR DNA replication complex GINS protein psf3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drc-3 PE=3 SV=1 1 179 6.0E-66
sp|Q4WQ54|PSF3_ASPFU DNA replication complex GINS protein psf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=psf3 PE=3 SV=2 1 179 7.0E-49
sp|Q0UPV4|PSF3_PHANO DNA replication complex GINS protein PSF3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PSF3 PE=3 SV=1 2 179 4.0E-47
sp|Q2GPK5|PSF3_CHAGB DNA replication complex GINS protein PSF3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PSF3 PE=3 SV=1 1 142 4.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA5|PSF3_GIBZE DNA replication complex GINS protein PSF3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PSF3 PE=3 SV=1 1 180 4.0E-91
sp|Q7S432|PSF3_NEUCR DNA replication complex GINS protein psf3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drc-3 PE=3 SV=1 1 179 6.0E-66
sp|Q4WQ54|PSF3_ASPFU DNA replication complex GINS protein psf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=psf3 PE=3 SV=2 1 179 7.0E-49
sp|Q0UPV4|PSF3_PHANO DNA replication complex GINS protein PSF3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PSF3 PE=3 SV=1 2 179 4.0E-47
sp|Q2GPK5|PSF3_CHAGB DNA replication complex GINS protein PSF3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PSF3 PE=3 SV=1 1 142 4.0E-36
sp|Q12146|PSF3_YEAST DNA replication complex GINS protein PSF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSF3 PE=1 SV=2 1 174 1.0E-31
sp|Q9UTC3|PSF3_SCHPO DNA replication complex GINS protein psf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psf3 PE=3 SV=1 1 178 7.0E-28
sp|Q6BYZ4|PSF3_DEBHA DNA replication complex GINS protein PSF3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PSF3 PE=3 SV=2 2 174 1.0E-25
sp|Q5AFK3|PSF3_CANAL DNA replication complex GINS protein PSF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PSF3 PE=3 SV=1 3 174 1.0E-24
sp|Q6CPV6|PSF3_KLULA DNA replication complex GINS protein PSF3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PSF3 PE=3 SV=1 1 174 3.0E-23
sp|Q74Z08|PSF3_ASHGO DNA replication complex GINS protein PSF3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF3 PE=3 SV=1 1 173 5.0E-22
sp|Q6FW66|PSF3_CANGA DNA replication complex GINS protein PSF3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PSF3 PE=3 SV=1 1 174 6.0E-21
sp|P0CQ32|PSF3_CRYNJ DNA replication complex GINS protein PSF3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PSF3 PE=3 SV=1 3 175 3.0E-13
sp|P0CQ33|PSF3_CRYNB DNA replication complex GINS protein PSF3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PSF3 PE=3 SV=1 3 175 3.0E-13
sp|Q54EH6|PSF3_DICDI Probable DNA replication complex GINS protein PSF3 OS=Dictyostelium discoideum GN=gins3 PE=3 SV=1 1 174 4.0E-13
sp|Q9BRX5|PSF3_HUMAN DNA replication complex GINS protein PSF3 OS=Homo sapiens GN=GINS3 PE=1 SV=1 7 173 5.0E-12
sp|Q5RDV0|PSF3_PONAB DNA replication complex GINS protein PSF3 OS=Pongo abelii GN=GINS3 PE=2 SV=1 7 173 1.0E-11
sp|Q9CY94|PSF3_MOUSE DNA replication complex GINS protein PSF3 OS=Mus musculus GN=Gins3 PE=2 SV=1 7 173 2.0E-11
sp|Q08E12|PSF3_BOVIN DNA replication complex GINS protein PSF3 OS=Bos taurus GN=GINS3 PE=2 SV=1 7 173 8.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|397
MSYYDPDSILTDAEKVPCQFELDVPYLGHLDSSTHGLKPGTQLSLPLWLAEMLALASGGDDARAPLTLNLPTCLS
DTVVNALKADPRAVPLRDQCVYFYGVAVRMLDLFDEGELAAVLRKSFILRAADVGLHARKADESGGGSQGQEFLR
GLDEWERNLFRRGHEGVKAAREWMDNVNKS*
Coding >OphauB2|397
ATGTCATACTACGACCCTGATTCTATACTAACGGATGCAGAGAAAGTCCCCTGCCAATTCGAGCTCGACGTCCCC
TACCTCGGCCACCTCGACAGCTCTACCCATGGCCTCAAACCCGGCACCCAGCTCTCCCTCCCCCTCTGGCTCGCC
GAAATGCTAGCCCTTGCCTCTGGCGGCGACGACGCCCGCGCCCCGCTTACCCTTAACCTCCCCACCTGCCTCTCC
GACACCGTCGTCAACGCCCTCAAGGCTGATCCTCGCGCCGTGCCCTTGCGCGACCAGTGCGTCTACTTTTACGGC
GTGGCTGTGCGCATGCTCGATCTCTTTGACGAGGGCGAGCTGGCTGCCGTTTTGCGCAAGTCGTTTATCCTGCGC
GCTGCAGATGTTGGACTGCATGCGCGCAAGGCAGACGAGAGTGGTGGAGGGAGCCAGGGCCAAGAGTTTTTGCGC
GGCCTTGATGAATGGGAGAGGAACCTGTTTCGACGTGGACATGAGGGTGTAAAGGCGGCGAGAGAGTGGATGGAC
AATGTCAACAAGAGTTAA
Transcript >OphauB2|397
ATGTCATACTACGACCCTGATTCTATACTAACGGATGCAGAGAAAGTCCCCTGCCAATTCGAGCTCGACGTCCCC
TACCTCGGCCACCTCGACAGCTCTACCCATGGCCTCAAACCCGGCACCCAGCTCTCCCTCCCCCTCTGGCTCGCC
GAAATGCTAGCCCTTGCCTCTGGCGGCGACGACGCCCGCGCCCCGCTTACCCTTAACCTCCCCACCTGCCTCTCC
GACACCGTCGTCAACGCCCTCAAGGCTGATCCTCGCGCCGTGCCCTTGCGCGACCAGTGCGTCTACTTTTACGGC
GTGGCTGTGCGCATGCTCGATCTCTTTGACGAGGGCGAGCTGGCTGCCGTTTTGCGCAAGTCGTTTATCCTGCGC
GCTGCAGATGTTGGACTGCATGCGCGCAAGGCAGACGAGAGTGGTGGAGGGAGCCAGGGCCAAGAGTTTTTGCGC
GGCCTTGATGAATGGGAGAGGAACCTGTTTCGACGTGGACATGAGGGTGTAAAGGCGGCGAGAGAGTGGATGGAC
AATGTCAACAAGAGTTAA
Gene >OphauB2|397
ATGTCATACTACGACCCTGATTCTATACTAACGGATGCAGAGGTACTCTTCCTCTTTGCATATTTATTTTTATTT
TCATCATTGTTTTTCGTACACGCAAACTAACTAGCGTCCGCCTAGAAAGTCCCCTGCCAATTCGAGCTCGACGTC
CCCTACCTCGGCCACCTCGACAGCTCTACCCATGGCCTCAAACCCGGCACCCAGCTCTCCCTCCCCCTCTGGCTC
GCCGAAATGCTAGCCCTTGCCTCTGGCGGCGACGACGCCCGCGCCCCGCTTACCCTTAACCTCCCCACCTGCCTC
TCCGACACCGTCGTCAACGCCCTCAAGGCTGATCCTCGCGCCGTGCCCTTGCGCGACCAGTGCGTCTACTTTTAC
GGCGTGGCTGTGCGCATGCTCGATCTCTTTGACGAGGGCGAGCTGGCTGCCGTTTTGCGCAAGTCGTTTATCCTG
CGCGCTGCAGATGTTGGACTGCATGCGCGCAAGGCAGACGAGAGTGGTGGAGGGAGCCAGGGCCAAGAGTTTTTG
CGCGGCCTTGATGAATGGGAGAGGAACCTGTTTCGACGTGGACATGAGGGTGTAAAGGCGGCGAGAGAGTGGATG
GACAATGTCAACAAGAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail